Gene/Proteome Database (LMPD)
LMPD ID
LMP002713
Gene ID
Species
Homo sapiens (Human)
Gene Name
inositol(myo)-1(or 4)-monophosphatase 2
Gene Symbol
Synonyms
-
Alternate Names
inositol monophosphatase 2; IMP 2; IMPase 2; inosine monophosphatase 2; myo-inositol monophosphatase A2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
Chromosome
18
Map Location
18p11.2
EC Number
3.1.3.25
Summary
This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]
Orthologs
Proteins
| inositol monophosphatase 2 | |
|---|---|
| Refseq ID | NP_055029 |
| Protein GI | 7657236 |
| UniProt ID | O14732 |
| mRNA ID | NM_014214 |
| Length | 288 |
| RefSeq Status | REVIEWED |
| MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK | |
Gene Information
Entrez Gene ID
Gene Name
inositol(myo)-1(or 4)-monophosphatase 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:MGI | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0008934 | IDA:MGI | F | inositol monophosphate 1-phosphatase activity |
| GO:0052832 | IEA:UniProtKB-EC | F | inositol monophosphate 3-phosphatase activity |
| GO:0052833 | IEA:UniProtKB-EC | F | inositol monophosphate 4-phosphatase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0042803 | IDA:MGI | F | protein homodimerization activity |
| GO:0006021 | IEA:UniProtKB-UniPathway | P | inositol biosynthetic process |
| GO:0046855 | IDA:MGI | P | inositol phosphate dephosphorylation |
| GO:0043647 | TAS:Reactome | P | inositol phosphate metabolic process |
| GO:0006796 | TAS:ProtInc | P | phosphate-containing compound metabolic process |
| GO:0046854 | IEA:InterPro | P | phosphatidylinositol phosphorylation |
| GO:0007165 | TAS:ProtInc | P | signal transduction |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00562 | Inositol phosphate metabolism |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6363 | D-myo-inositol (1,4,5)-trisphosphate degradation |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150352 | Synthesis of IP2, IP, and Ins in the cytosol |
Domain Information
UniProt Annotations
Entry Information
Gene Name
inositol(myo)-1(or 4)-monophosphatase 2
Protein Entry
IMPA2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=O14732-1; Sequence=Displayed; Name=2; Synonyms=A2b; IsoId=O14732-2; Sequence=VSP_013674; |
| Biophysicochemical Properties | Kinetic parameters: KM=5 mM for myo-inositol 1-monophosphate ; pH dependence: Optimum pH is 7.5-8.0. ; |
| Catalytic Activity | Myo-inositol phosphate + H(2)O = myo-inositol + phosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI |
| Enzyme Regulation | Inhibited by high Li(+) and restricted Mg(2+) concentrations. {ECO |
| Function | Can use myo-inositol monophosphates, scylloinositol 1,4- diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'- AMP as substrates. Has been implicated as the pharmacological target for lithium Li(+) action in brain. |
| Induction | Repressed by Li(+). |
| Pathway | Polyol metabolism; myo-inositol biosynthesis; myo- inositol from D-glucose 6-phosphate: step 2/2. |
| Similarity | Belongs to the inositol monophosphatase family. |
| Subunit | Homodimer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002713 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 7657236 | RefSeq | NP_055029 | 288 | inositol monophosphatase 2 |
Identical Sequences to LMP002713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657236 | GenBank | AAX42156.1 | 288 | inositol(myo)-1 or 4-monophosphatase 2 [synthetic construct] |
| GI:7657236 | GenBank | AAX42157.1 | 288 | inositol(myo)-1 or 4-monophosphatase 2 [synthetic construct] |
| GI:7657236 | GenBank | EAX01559.1 | 288 | inositol(myo)-1(or 4)-monophosphatase 2, isoform CRA_b [Homo sapiens] |
| GI:7657236 | GenBank | ACA06007.1 | 288 | inositol monophosphatase 2 variant 1 [Homo sapiens] |
| GI:7657236 | GenBank | AEF64129.1 | 288 | Sequence 124 from patent US 7932032 |
| GI:7657236 | GenBank | AFN90231.1 | 288 | Sequence 124 from patent US 8198025 |
Related Sequences to LMP002713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:7657236 | GenBank | AAP36195.1 | 289 | Homo sapiens inositol(myo)-1(or 4)-monophosphatase 2, partial [synthetic construct] |
| GI:7657236 | GenBank | AAX29620.1 | 289 | inositol(myo)-monophosphatase 2, partial [synthetic construct] |
| GI:7657236 | GenBank | AAX29621.1 | 289 | inositol(myo)-monophosphatase 2, partial [synthetic construct] |
| GI:7657236 | PDB | 2CZH | 299 | Chain B, Crystal Structure Of Human Myo-Inositol Monophosphatase 2 (Impa2) With Phosphate Ion (Orthorhombic Form) |
| GI:7657236 | PDB | 2CZI | 299 | Chain A, Crystal Structure Of Human Myo-Inositol Monophosphatase 2 (Impa2) With Calcium And Phosphate Ions |
| GI:7657236 | PDB | 2CZK | 299 | Chain A, Crystal Structure Of Human Myo-Inositol Monophosphatase 2 (Impa2) (Trigonal Form) |