Gene/Proteome Database (LMPD)

LMPD ID
LMP002772
Gene ID
Species
Mus musculus (Mouse)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Symbol
Synonyms
Gal-T2; Galt2
Alternate Names
beta-1,3-galactosyltransferase 4; b3Gal-T4; beta3GalT4; beta3Gal-T4; beta-1,3-GalTase 4; ganglioside galactosyltransferase; UDP-Gal:betaGlcNAc beta 13-galactosyltransferase polypeptide 4; UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase
Chromosome
17
Map Location
17 B1|17
EC Number
2.4.1.62

Proteins

beta-1,3-galactosyltransferase 4
Refseq ID NP_062293
Protein GI 9506417
UniProt ID Q9Z0F0
mRNA ID NM_019420
Length 371
RefSeq Status VALIDATED
MPLSLFRRVLLAVLLLVIIWTLFGPSGLGEELLSLSLASLLPAPASPGPPLALPRLLISNSHACGGSGPPPFLLILVCTAPEHLNQRNAIRASWGAIREARGFRVQTLFLLGKPRRQQLADLSSESAAHRDILQASFQDSYRNLTLKTLSGLNWVNKYCPMARYILKTDDDVYVNVPELVSELIQRGGPSEQWQKGKEAQEETTAIHEEHRGQAVPLLYLGRVHWRVRPTRTPESRHHVSEELWPENWGPFPPYASGTGYVLSISAVQLILKVASRAPPLPLEDVFVGVSARRGGLAPTHCVKLAGATHYPLDRCCYGKFLLTSHKVDPWQMQEAWKLVSGMNGERTAPFCSWLQGFLGTLRCRFIAWFSS

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0047915 IEA:UniProtKB-EC F ganglioside galactosyltransferase activity
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00604 Glycosphingolipid biosynthesis - ganglio series
mmu01100 Metabolic pathways
ko00514 Other types of O-glycan biosynthesis
mmu00514 Other types of O-glycan biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4
Protein Entry
B3GT4_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Catalytic Activity UDP-alpha-D-galactose + an N-acetyl-beta-D- galactosaminyl-(1->4)-(alpha-N-acetylneuraminyl-(2->3))-beta-D- galactosyl-(1->4)-beta-D-glucosyl-(1<->1)-ceramide = UDP + a beta- D-galactosyl-(1->3)-N-acetyl-beta-D-galactosaminyl-(1->4)-(alpha- N-acetylneuraminyl-(2->3))-beta-D-galactosyl-(1->4)-beta-D- glucosyl-(1<->1)-ceramide.
Developmental Stage First expressed at embryonic day 3. Maintained at high levels between days 4 and 7 and declines thereafter to stabilize at low levels after day 10. {ECO:0000269|PubMed:10502288}.
Function Involved in GM1/GD1B/GA1 ganglioside biosynthesis. {ECO:0000269|PubMed:10502288}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 31 family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane; Single-pass type II membrane protein.
Tissue Specificity Expressed in heart, brain, spleen, kidney, lung and testis. {ECO:0000269|PubMed:10502288}.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=b3GalT4; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_457";

Identical and Related Proteins

Unique RefSeq proteins for LMP002772 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
9506417 RefSeq NP_062293 371 beta-1,3-galactosyltransferase 4

Identical Sequences to LMP002772 proteins

Reference Database Accession Length Protein Name
GI:9506417 GenBank AAC97977.1 371 beta 1,3-galactosyl transferase [Mus musculus]
GI:9506417 GenBank EDL10230.1 371 mCG22996 [Mus musculus]
GI:9506417 GenBank AAI72608.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4, partial [synthetic construct]
GI:9506417 GenBank AAI72719.1 371 UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 [synthetic construct]
GI:9506417 GenBank AIC84001.1 371 UDP-Gal:betaGlcNAc beta 13-galactosyltransferase polypeptide 4 [Mus musculus]
GI:9506417 SwissProt Q9Z0F0.1 371 RecName: Full=Beta-1,3-galactosyltransferase 4; Short=Beta-1,3-GalTase 4; Short=Beta3Gal-T4; Short=Beta3GalT4; Short=b3Gal-T4; AltName: Full=Gal-T2; AltName: Full=Ganglioside galactosyltransferase; AltName: Full=UDP-galactose:beta-N-acetyl-galactosamine-beta-1,3-galactosyltransferase [Mus musculus]

Related Sequences to LMP002772 proteins

Reference Database Accession Length Protein Name
GI:9506417 DBBJ BAB68689.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus brevirostris]
GI:9506417 DBBJ BAB68691.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus castaneus]
GI:9506417 DBBJ BAB68692.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus molossinus]
GI:9506417 DBBJ BAB68694.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus molossinus]
GI:9506417 DBBJ BAB68695.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus castaneus]
GI:9506417 DBBJ BAB68696.1 370 GM1/GD1b/GA1 synthase, partial [Mus musculus musculus]