Gene/Proteome Database (LMPD)

LMPD ID
LMP002785
Gene ID
79464
Species
Mus musculus (Mouse)
Gene Name
lipoic acid synthetase
Gene Symbol
Lias
Synonyms
2900022L22Rik; 4933425M12Rik; 7a5ex; C77512; mLip1
Alternate Names
lipoyl synthase, mitochondrial; LS; lip-syn; lipoate synthase; lipoic acid synthase
Chromosome
5
Map Location
5|5 C3.3
EC Number
2.8.1.8

Proteins

lipoyl synthase, mitochondrial precursor
Refseq ID NP_077791
Protein GI 13277380
UniProt ID Q99M04
mRNA ID NM_024471
Length 373
RefSeq Status PROVISIONAL
MALRCWDTARSLGSRIFGRYAFTVRALSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKASKV
transit_peptide: 1..26 experiment: experimental evidence, no additional details recorded note: Mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03123}; propagated from UniProtKB/Swiss-Prot (Q99M04.1) calculated_mol_wt: 3006 peptide sequence: MALRCWDTARSLGSRIFGRYAFTVRA mat_peptide: 27..373 product: Lipoyl synthase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q99M04.1) calculated_mol_wt: 38892 peptide sequence: LSSLPDKKKEFLHNGPDLQDFVSGDLADKSTWDEYKGNLKRQKGERLRLPPWLKTKIPMGKNYNKLKNTLRNLSLHTVCEEARCPNIGECWGGGEYATATATIMLMGDTCTRGCRFCSVKTARNPPPLDANEPDNTAKAIAEWGLDYVVLTSVDRDDVADGGAEHIAKTVSCLKERNPKILVECLTPDFRGDLRAVEKVALSGLDVYAHNVETVPELQRKVRDPRANFDQSLRVLRHAKEVQPDVVSKTSIMLGLGETDEQVYATLKALRAADVDCLTLGQYMQPTKRHLKVEEYVTPEKFKYWEKVGNELGFLYTASGPLVRSSYKAGEFFLKNLVARRKTKASKV

Gene Information

Entrez Gene ID
79464
Gene Name
lipoic acid synthetase
Gene Symbol
Lias
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:MGI C mitochondrion
GO:0051539 IEA:UniProtKB-HAMAP F 4 iron, 4 sulfur cluster binding
GO:0016992 IGI:MGI F lipoate synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006954 IMP:MGI P inflammatory response
GO:0009107 IGI:MGI P lipoate biosynthetic process
GO:0001843 IMP:MGI P neural tube closure
GO:0009249 IEA:UniProtKB-HAMAP P protein lipoylation
GO:0032496 IMP:MGI P response to lipopolysaccharide
GO:0006979 IMP:MGI P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
mmu00785 Lipoic acid metabolism
mmu01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY0-501 lipoate biosynthesis and incorporation I
PWY0-1275 lipoate biosynthesis and incorporation II

Domain Information

InterPro Annotations

Accession Description
IPR013785 Aldolase-type TIM barrel
IPR006638 Elongator protein 3/MiaB/NifB
IPR003698 Lipoyl synthase
IPR007197 Radical SAM

UniProt Annotations

Entry Information

Gene Name
lipoic acid synthetase
Protein Entry
LIAS_MOUSE
UniProt ID
Q99M04
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Protein N(6)-(octanoyl)lysine + 2 sulfur- (sulfur carrier) + 2 S-adenosyl-L-methionine = protein N(6)- (lipoyl)lysine + 2 (sulfur carrier) + 2 L-methionine + 2 5'- deoxyadenosine.
Cofactor Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883; Evidence={ECO:0000255|HAMAP-Rule:MF_03123}; Note=Binds 2 [4Fe-4S] clusters per subunit. One cluster is coordinated with 3 cysteines and an exchangeable S-adenosyl-L- methionine. {ECO:0000255|HAMAP-Rule:MF_03123};
Function Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives. {ECO:0000305}.
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 2/2. {ECO:0000255|HAMAP-Rule:MF_03123}.
Similarity Belongs to the radical SAM superfamily. Lipoyl synthase family. {ECO:0000255|HAMAP-Rule:MF_03123}.
Subcellular Location Mitochondrion {ECO:0000255|HAMAP- Rule:MF_03123, ECO:0000269|PubMed:11389890}.
Tissue Specificity Expressed predominantly in heart, testis, and liver. {ECO:0000269|PubMed:11389890}.

Identical and Related Proteins

Unique RefSeq proteins for LMP002785 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13277380 RefSeq NP_077791 373 lipoyl synthase, mitochondrial precursor

Identical Sequences to LMP002785 proteins

Reference Database Accession Length Protein Name
GI:13277380 DBBJ BAC33443.1 373 unnamed protein product [Mus musculus]
GI:13277380 DBBJ BAC33804.1 373 unnamed protein product [Mus musculus]
GI:13277380 DBBJ BAC36672.1 373 unnamed protein product [Mus musculus]
GI:13277380 EMBL CBN72488.1 373 unnamed protein product [Mus musculus]
GI:13277380 GenBank EDL37739.1 373 lipoic acid synthetase, isoform CRA_a [Mus musculus]
GI:13277380 SwissProt Q99M04.1 373 RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; Short=mLIP1; AltName: Full=Lipoic acid synthase; Flags: Precursor [Mus musculus]

Related Sequences to LMP002785 proteins

Reference Database Accession Length Protein Name
GI:13277380 DBBJ BAC27579.1 373 unnamed protein product [Mus musculus]
GI:13277380 EMBL CBN72402.1 373 unnamed protein product [Rattus norvegicus]
GI:13277380 EMBL CBN72483.1 373 unnamed protein product [Mus musculus]
GI:13277380 GenBank AAH83708.1 373 Lipoic acid synthetase [Rattus norvegicus]
GI:13277380 RefSeq NP_001012037.1 373 lipoyl synthase, mitochondrial precursor [Rattus norvegicus]
GI:13277380 SwissProt Q5XIH4.1 373 RecName: Full=Lipoyl synthase, mitochondrial; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoic acid synthase; Flags: Precursor [Rattus norvegicus]