Gene/Proteome Database (LMPD)
LMPD ID
LMP002796
Gene ID
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group X
Gene Symbol
Synonyms
GXPLA2; GXSPLA2; SPLA2
Alternate Names
group 10 secretory phospholipase A2; sPLA2-X; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10
Chromosome
16
Map Location
16p13.1-p12
EC Number
3.1.1.4
Proteins
group 10 secretory phospholipase A2 precursor | |
---|---|
Refseq ID | NP_003552 |
Protein GI | 4505845 |
UniProt ID | O15496 |
mRNA ID | NM_003561 |
Length | 165 |
RefSeq Status | PROVISIONAL |
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD | |
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3165 peptide sequence: MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSG mat_peptide: 43..165 product: Group 10 secretory phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O15496.3) calculated_mol_wt: 13632 peptide sequence: GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | TAS:Reactome | C | extracellular region |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0004623 | TAS:ProtInc | F | phospholipase A2 activity |
GO:0004620 | ISS:BHF-UCL | F | phospholipase activity |
GO:0019369 | NAS:BHF-UCL | P | arachidonic acid metabolic process |
GO:0007411 | IDA:MGI | P | axon guidance |
GO:0042632 | ISS:BHF-UCL | P | cholesterol homeostasis |
GO:0046474 | TAS:Reactome | P | glycerophospholipid biosynthetic process |
GO:0016042 | IEA:UniProtKB-KW | P | lipid catabolic process |
GO:0051977 | IDA:MGI | P | lysophospholipid transport |
GO:0090370 | ISS:BHF-UCL | P | negative regulation of cholesterol efflux |
GO:0043433 | IDA:BHF-UCL | P | negative regulation of sequence-specific DNA binding transcription factor activity |
GO:0006654 | TAS:Reactome | P | phosphatidic acid biosynthetic process |
GO:0036151 | TAS:Reactome | P | phosphatidylcholine acyl-chain remodeling |
GO:0036152 | TAS:Reactome | P | phosphatidylethanolamine acyl-chain remodeling |
GO:0036148 | TAS:Reactome | P | phosphatidylglycerol acyl-chain remodeling |
GO:0036149 | TAS:Reactome | P | phosphatidylinositol acyl-chain remodeling |
GO:0036150 | TAS:Reactome | P | phosphatidylserine acyl-chain remodeling |
GO:0006644 | TAS:Reactome | P | phospholipid metabolic process |
GO:0090238 | ISS:BHF-UCL | P | positive regulation of arachidonic acid secretion |
GO:0032270 | IMP:BHF-UCL | P | positive regulation of cellular protein metabolic process |
GO:0010884 | IMP:BHF-UCL | P | positive regulation of lipid storage |
GO:0010744 | IC:BHF-UCL | P | positive regulation of macrophage derived foam cell differentiation |
GO:0032308 | IMP:BHF-UCL | P | positive regulation of prostaglandin secretion |
GO:0043030 | IMP:BHF-UCL | P | regulation of macrophage activation |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO |
Cofactor | Name=Ca(2+); Xref=ChEBI |
Function | PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine. |
Similarity | Belongs to the phospholipase A2 family. |
Subcellular Location | Secreted. |
Tissue Specificity | Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002796 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4505845 | RefSeq | NP_003552 | 165 | group 10 secretory phospholipase A2 precursor |
Identical Sequences to LMP002796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505845 | GenBank | AEU43321.1 | 165 | Sequence 70 from patent US 8052970 |
GI:4505845 | GenBank | AGF22444.1 | 165 | Sequence 10 from patent US 8372594 |
GI:4505845 | GenBank | AIC50110.1 | 165 | PLA2G10, partial [synthetic construct] |
GI:4505845 | RefSeq | XP_006721021.1 | 165 | PREDICTED: group 10 secretory phospholipase A2 isoform X1 [Homo sapiens] |
GI:4505845 | RefSeq | XP_006725277.1 | 165 | PREDICTED: group 10 secretory phospholipase A2 isoform X1 [Homo sapiens] |
GI:4505845 | SwissProt | O15496.3 | 165 | RecName: Full=Group 10 secretory phospholipase A2; AltName: Full=Group X secretory phospholipase A2; Short=GX sPLA2; Short=sPLA2-X; AltName: Full=Phosphatidylcholine 2-acylhydrolase 10; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP002796 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4505845 | GenBank | AAW12534.1 | 155 | Sequence 10 from patent US 6812017 |
GI:4505845 | GenBank | AEU43288.1 | 155 | Sequence 37 from patent US 8052970 |
GI:4505845 | GenBank | JAB05381.1 | 166 | group 10 secretory phospholipase A2 precursor [Callithrix jacchus] |
GI:4505845 | RefSeq | XP_003928804.1 | 166 | PREDICTED: group 10 secretory phospholipase A2 [Saimiri boliviensis boliviensis] |
GI:4505845 | RefSeq | XP_005591357.1 | 165 | PREDICTED: group 10 secretory phospholipase A2 [Macaca fascicularis] |
GI:4505845 | RefSeq | XP_007984539.1 | 165 | PREDICTED: group 10 secretory phospholipase A2 [Chlorocebus sabaeus] |