Gene/Proteome Database (LMPD)

LMPD ID
LMP002796
Gene ID
8399
Species
Homo sapiens (Human)
Gene Name
phospholipase A2, group X
Gene Symbol
PLA2G10
Synonyms
GXPLA2; GXSPLA2; SPLA2
Alternate Names
group 10 secretory phospholipase A2; sPLA2-X; GX sPLA2; group X secretory phospholipase A2; phosphatidylcholine 2-acylhydrolase 10
Chromosome
16
Map Location
16p13.1-p12
EC Number
3.1.1.4

Proteins

group 10 secretory phospholipase A2 precursor
Refseq ID NP_003552
Protein GI 4505845
UniProt ID O15496
mRNA ID NM_003561
Length 165
RefSeq Status PROVISIONAL
MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSGEASRILRVHRRGILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD
sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3165 peptide sequence: MGPLPVCLPIMLLLLLPSLLLLLLLPGPGSG mat_peptide: 43..165 product: Group 10 secretory phospholipase A2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (O15496.3) calculated_mol_wt: 13632 peptide sequence: GILELAGTVGCVGPRTPIAYMKYGCFCGLGGHGQPRDAIDWCCHGHDCCYTRAEEAGCSPKTERYSWQCVNQSVLCGPAENKCQELLCKCDQEIANCLAQTEYNLKYLFYPQFLCEPDSPKCD

Gene Information

Entrez Gene ID
8399
Gene Name
phospholipase A2, group X
Gene Symbol
PLA2G10
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 TAS:Reactome C extracellular region
GO:0005509 IEA:InterPro F calcium ion binding
GO:0004623 TAS:ProtInc F phospholipase A2 activity
GO:0004620 ISS:BHF-UCL F phospholipase activity
GO:0019369 NAS:BHF-UCL P arachidonic acid metabolic process
GO:0007411 IDA:MGI P axon guidance
GO:0042632 ISS:BHF-UCL P cholesterol homeostasis
GO:0046474 TAS:Reactome P glycerophospholipid biosynthetic process
GO:0016042 IEA:UniProtKB-KW P lipid catabolic process
GO:0051977 IDA:MGI P lysophospholipid transport
GO:0090370 ISS:BHF-UCL P negative regulation of cholesterol efflux
GO:0043433 IDA:BHF-UCL P negative regulation of sequence-specific DNA binding transcription factor activity
GO:0006654 TAS:Reactome P phosphatidic acid biosynthetic process
GO:0036151 TAS:Reactome P phosphatidylcholine acyl-chain remodeling
GO:0036152 TAS:Reactome P phosphatidylethanolamine acyl-chain remodeling
GO:0036148 TAS:Reactome P phosphatidylglycerol acyl-chain remodeling
GO:0036149 TAS:Reactome P phosphatidylinositol acyl-chain remodeling
GO:0036150 TAS:Reactome P phosphatidylserine acyl-chain remodeling
GO:0006644 TAS:Reactome P phospholipid metabolic process
GO:0090238 ISS:BHF-UCL P positive regulation of arachidonic acid secretion
GO:0032270 IMP:BHF-UCL P positive regulation of cellular protein metabolic process
GO:0010884 IMP:BHF-UCL P positive regulation of lipid storage
GO:0010744 IC:BHF-UCL P positive regulation of macrophage derived foam cell differentiation
GO:0032308 IMP:BHF-UCL P positive regulation of prostaglandin secretion
GO:0043030 IMP:BHF-UCL P regulation of macrophage activation
GO:0044281 TAS:Reactome P small molecule metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04975 Fat digestion and absorption
hsa04972 Pancreatic secretion
hsa04014 Ras signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR001211 Phospholipase A2
IPR013090 Phospholipase A2, active site
IPR016090 Phospholipase A2 domain

UniProt Annotations

Entry Information

Gene Name
phospholipase A2, group X
Protein Entry
PA2GX_HUMAN
UniProt ID
O15496
Species
Human

Comments

Comment Type Description
Catalytic Activity Phosphatidylcholine + H(2)O = 1- acylglycerophosphocholine + a carboxylate. {ECO
Cofactor Name=Ca(2+); Xref=ChEBI
Function PA2 catalyzes the calcium-dependent hydrolysis of the 2- acyl groups in 3-sn-phosphoglycerides. Has a powerful potency for releasing arachidonic acid from cell membrane phospholipids. Prefers phosphatidylethanolamine and phosphatidylcholine liposomes to those of phosphatidylserine.
Similarity Belongs to the phospholipase A2 family.
Subcellular Location Secreted.
Tissue Specificity Found in spleen, thymus, peripheral blood leukocytes, pancreas, lung, and colon.

Identical and Related Proteins

Unique RefSeq proteins for LMP002796 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
4505845 RefSeq NP_003552 165 group 10 secretory phospholipase A2 precursor

Identical Sequences to LMP002796 proteins

Reference Database Accession Length Protein Name
GI:4505845 GenBank AEU43321.1 165 Sequence 70 from patent US 8052970
GI:4505845 GenBank AGF22444.1 165 Sequence 10 from patent US 8372594
GI:4505845 GenBank AIC50110.1 165 PLA2G10, partial [synthetic construct]
GI:4505845 RefSeq XP_006721021.1 165 PREDICTED: group 10 secretory phospholipase A2 isoform X1 [Homo sapiens]
GI:4505845 RefSeq XP_006725277.1 165 PREDICTED: group 10 secretory phospholipase A2 isoform X1 [Homo sapiens]
GI:4505845 SwissProt O15496.3 165 RecName: Full=Group 10 secretory phospholipase A2; AltName: Full=Group X secretory phospholipase A2; Short=GX sPLA2; Short=sPLA2-X; AltName: Full=Phosphatidylcholine 2-acylhydrolase 10; Flags: Precursor [Homo sapiens]

Related Sequences to LMP002796 proteins

Reference Database Accession Length Protein Name
GI:4505845 GenBank AAW12534.1 155 Sequence 10 from patent US 6812017
GI:4505845 GenBank AEU43288.1 155 Sequence 37 from patent US 8052970
GI:4505845 GenBank JAB05381.1 166 group 10 secretory phospholipase A2 precursor [Callithrix jacchus]
GI:4505845 RefSeq XP_003928804.1 166 PREDICTED: group 10 secretory phospholipase A2 [Saimiri boliviensis boliviensis]
GI:4505845 RefSeq XP_005591357.1 165 PREDICTED: group 10 secretory phospholipase A2 [Macaca fascicularis]
GI:4505845 RefSeq XP_007984539.1 165 PREDICTED: group 10 secretory phospholipase A2 [Chlorocebus sabaeus]