Gene/Proteome Database (LMPD)
Proteins
membrane-associated progesterone receptor component 1 | |
---|---|
Refseq ID | NP_058063 |
Protein GI | 31980806 |
UniProt ID | O55022 |
mRNA ID | NM_016783 |
Length | 195 |
RefSeq Status | PROVISIONAL |
MAAEDVVATGADPSELEGGGLLHEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLSDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDETARKNE |
Gene Information
Entrez Gene ID
Gene Name
progesterone receptor membrane component 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005730 | IEA:Ensembl | C | nucleolus |
GO:0020037 | IEA:InterPro | F | heme binding |
GO:0005496 | IEA:UniProtKB-KW | F | steroid binding |
GO:0007411 | IEA:Ensembl | P | axon guidance |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001199 | Cytochrome b5-like heme/steroid binding domain |
UniProt Annotations
Entry Information
Gene Name
progesterone receptor membrane component 1
Protein Entry
PGRC1_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Domain | The cytochrome b5 heme-binding domain lacks the conserved iron-binding His residues at positions 107 and 131. {ECO:0000250}. |
Function | Receptor for progesterone. {ECO:0000250}. |
Similarity | Belongs to the cytochrome b5 family. MAPR subfamily. {ECO:0000305}. |
Similarity | Contains 1 cytochrome b5 heme-binding domain. {ECO:0000305}. |
Subcellular Location | Microsome membrane {ECO:0000250}; Single- pass membrane protein {ECO:0000250}. Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002808 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
31980806 | RefSeq | NP_058063 | 195 | membrane-associated progesterone receptor component 1 |
Identical Sequences to LMP002808 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31980806 | DBBJ | BAE35007.1 | 195 | unnamed protein product [Mus musculus] |
GI:31980806 | DBBJ | BAE35219.1 | 195 | unnamed protein product [Mus musculus] |
GI:31980806 | DBBJ | BAE39706.1 | 195 | unnamed protein product [Mus musculus] |
GI:31980806 | DBBJ | BAE40700.1 | 195 | unnamed protein product [Mus musculus] |
GI:31980806 | GenBank | EDL28971.1 | 195 | progesterone receptor membrane component 1 [Mus musculus] |
GI:31980806 | GenBank | AFL62087.1 | 195 | Sequence 2 from patent US 8187821 |
Related Sequences to LMP002808 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:31980806 | DBBJ | BAE40314.1 | 195 | unnamed protein product [Mus musculus] |
GI:31980806 | GenBank | AAB97466.1 | 195 | putative membrane associated progesterone receptor component [Mus musculus] |
GI:31980806 | RefSeq | XP_001914740.1 | 195 | PREDICTED: LOW QUALITY PROTEIN: membrane-associated progesterone receptor component 1 [Equus caballus] |
GI:31980806 | RefSeq | XP_005319441.1 | 195 | PREDICTED: membrane-associated progesterone receptor component 1 [Ictidomys tridecemlineatus] |
GI:31980806 | RefSeq | XP_006993676.1 | 195 | PREDICTED: membrane-associated progesterone receptor component 1 [Peromyscus maniculatus bairdii] |
GI:31980806 | RefSeq | XP_008842180.1 | 195 | PREDICTED: membrane-associated progesterone receptor component 1 [Nannospalax galili] |