Gene/Proteome Database (LMPD)
LMPD ID
LMP002872
Gene ID
Species
Homo sapiens (Human)
Gene Name
choroideremia (Rab escort protein 1)
Gene Symbol
Synonyms
DXS540; GGTA; HSD-32; REP-1; TCD
Alternate Names
rab proteins geranylgeranyltransferase component A 1
Chromosome
X
Map Location
Xq21.2
Summary
This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia; also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Feb 2009]
Orthologs
Proteins
rab proteins geranylgeranyltransferase component A 1 isoform a | |
---|---|
Refseq ID | NP_000381 |
Protein GI | 9966761 |
UniProt ID | P24386 |
mRNA ID | NM_000390 |
Length | 653 |
RefSeq Status | REVIEWED |
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYASQDLHEDVEEAGALQKNHALVTSANSTEAADSAFLPTEDESLSTMSCEMLTEQTPSSDPENALEVNGAEVTGEKENHCDDKTCVPSTSAEDMSENVPIAEDTTEQPKKNRITYSQIIKEGRRFNIDLVSKLLYSRGLLIDLLIKSNVSRYAEFKNITRILAFREGRVEQVPCSRADVFNSKQLTMVEKRMLMKFLTFCMEYEKYPDEYKGYEEITFYEYLKTQKLTPNLQYIVMHSIAMTSETASSTIDGLKATKNFLHCLGRYGNTPFLFPLYGQGELPQCFCRMCAVFGGIYCLRHSVQCLVVDKESRKCKAIIDQFGQRIISEHFLVEDSYFPENMCSRVQYRQISRAVLITDRSVLKTDSDQQISILTVPAEEPGTFAVRVIELCSSTMTCMKGTYLVHLTCTSSKTAREDLESVVQKLFVPYTEMEIENEQVEKPRILWALYFNMRDSSDISRSCYNDLPSNVYVCSGPDCGLGNDNAVKQAETLFQEICPNEDFCPPPPNPEDIILDGDSLQPEASESSAIPEANSETFKESTNLGNLEESSE |
rab proteins geranylgeranyltransferase component A 1 isoform b | |
---|---|
Refseq ID | NP_001138886 |
Protein GI | 224028271 |
UniProt ID | P24386 |
mRNA ID | NM_001145414 |
Length | 110 |
RefSeq Status | REVIEWED |
MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEVFCYARSTLLL |
Gene Information
Entrez Gene ID
Gene Name
choroideremia (Rab escort protein 1)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IMP:UniProtKB | C | cytosol |
GO:0005968 | IDA:UniProtKB | C | Rab-protein geranylgeranyltransferase complex |
GO:0005096 | IEA:UniProtKB-KW | F | GTPase activator activity |
GO:0004663 | TAS:ProtInc | F | Rab geranylgeranyltransferase activity |
GO:0017137 | IDA:UniProtKB | F | Rab GTPase binding |
GO:0001568 | IEA:Ensembl | P | blood vessel development |
GO:0018344 | IDA:UniProtKB | P | protein geranylgeranylation |
GO:0006612 | IMP:UniProtKB | P | protein targeting to membrane |
GO:0050896 | IEA:UniProtKB-KW | P | response to stimulus |
GO:0007601 | TAS:ProtInc | P | visual perception |
Domain Information
UniProt Annotations
Entry Information
Gene Name
choroideremia (Rab escort protein 1)
Protein Entry
RAE1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P24386-1; Sequence=Displayed; Name=2; IsoId=P24386-2; Sequence=VSP_042817, VSP_042818; Note=No experimental confirmation available.; |
Disease | Choroideremia (CHM) [MIM |
Function | Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B composed of RABGGTA and RABGGTB, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Besides, a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins; this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation. |
Similarity | Belongs to the Rab GDI family. |
Subcellular Location | Cytoplasm, cytosol . |
Subunit | Monomer. Heterotrimer composed of RABGGTA, RABGGTB and CHM; within this trimer, RABGGTA and RABGGTB form the catalytic component B, while CHM (component A) mediates Rab protein binding. Can associate with the Rab GGTase dimer (RGGT or component B) prior to Rab protein binding; the association is stabilized by geranylgeranyl pyrophosphate (GGpp). The CHM |
Web Resource | Name=Mutations of the REP1 gene; Note=Retina International's Scientific Newsletter; URL="http://www.retina-international.org/files/sci-news/repmut.htm"; |
Web Resource | Name=NGRL, Manchester LOVD choroideremia (Rab escort protein 1) (CHM); Note=Leiden Open Variation Database (LOVD); URL="http://ngrl.manchester.ac.uk/LOVDv.2.0/home.php?select_db=CHM"; |
Web Resource | Name=Retinal and hearing impairment genetic mutation database choroideremia (Rab escort protein 1) (CHM); Note=Leiden Open Variation Database (LOVD); URL="http://grenada.lumc.nl/LOVD2/Usher_montpellier/home.php?select_db=CHM"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP002872 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
9966761 | RefSeq | NP_000381 | 653 | rab proteins geranylgeranyltransferase component A 1 isoform a |
224028271 | RefSeq | NP_001138886 | 110 | rab proteins geranylgeranyltransferase component A 1 isoform b |
Identical Sequences to LMP002872 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9966761 | EMBL | CAD33401.1 | 653 | unnamed protein product [Homo sapiens] |
GI:9966761 | EMBL | CAV30743.1 | 653 | unnamed protein product [Homo sapiens] |
GI:9966761 | GenBank | EAW98559.1 | 653 | choroideremia (Rab escort protein 1) [Homo sapiens] |
GI:224028271 | GenBank | AAI30495.1 | 110 | CHM protein [Homo sapiens] |
GI:224028271 | GenBank | AAI30497.1 | 110 | CHM protein [Homo sapiens] |
GI:9966761 | GenBank | AAI56458.1 | 653 | Choroideremia (Rab escort protein 1), partial [synthetic construct] |
GI:9966761 | GenBank | AAI72532.1 | 653 | Choroideremia (Rab escort protein 1) [synthetic construct] |
GI:9966761 | SwissProt | P24386.3 | 653 | RecName: Full=Rab proteins geranylgeranyltransferase component A 1; AltName: Full=Choroideremia protein; AltName: Full=Rab escort protein 1; Short=REP-1; AltName: Full=TCD protein [Homo sapiens] |
Related Sequences to LMP002872 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9966761 | DBBJ | BAF83849.1 | 653 | unnamed protein product [Homo sapiens] |
GI:224028271 | EMBL | CAA55011.1 | 653 | choroidermia, Rab geranylgeranyltransferase component A (REP-1) [Homo sapiens] |
GI:224028271 | EMBL | CAV30743.1 | 653 | unnamed protein product [Homo sapiens] |
GI:224028271 | GenBank | EAW98559.1 | 653 | choroideremia (Rab escort protein 1) [Homo sapiens] |
GI:224028271 | GenBank | AAI56458.1 | 653 | Choroideremia (Rab escort protein 1), partial [synthetic construct] |
GI:9966761 | GenBank | ACM81756.1 | 661 | Sequence 7254 from patent US 6812339 |
GI:9966761 | GenBank | JAA07847.1 | 653 | choroideremia (Rab escort protein 1) [Pan troglodytes] |
GI:9966761 | GenBank | JAA07848.1 | 653 | choroideremia (Rab escort protein 1) [Pan troglodytes] |
GI:9966761 | GenBank | JAA07849.1 | 653 | choroideremia (Rab escort protein 1) [Pan troglodytes] |
GI:224028271 | RefSeq | NP_000381.1 | 653 | rab proteins geranylgeranyltransferase component A 1 isoform a [Homo sapiens] |
GI:9966761 | RefSeq | XP_003824489.1 | 653 | PREDICTED: rab proteins geranylgeranyltransferase component A 1 [Pan paniscus] |
GI:224028271 | SwissProt | P24386.3 | 653 | RecName: Full=Rab proteins geranylgeranyltransferase component A 1; AltName: Full=Choroideremia protein; AltName: Full=Rab escort protein 1; Short=REP-1; AltName: Full=TCD protein [Homo sapiens] |