Gene/Proteome Database (LMPD)
LMPD ID
LMP002936
Gene ID
Species
Mus musculus (Mouse)
Gene Name
zinc finger, DHHC domain containing 15
Gene Symbol
Synonyms
6030457O13Rik
Alternate Names
palmitoyltransferase ZDHHC15; DHHC-15; zinc finger DHHC domain-containing protein 15
Chromosome
X
Map Location
X D|X
EC Number
2.3.1.225
Proteins
palmitoyltransferase ZDHHC15 | |
---|---|
Refseq ID | NP_780567 |
Protein GI | 30425060 |
UniProt ID | Q8BGJ0 |
mRNA ID | NM_175358 |
Length | 337 |
RefSeq Status | VALIDATED |
MRRGWKMALSGGLRCCRRVLSWVPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFFAWTYWKSIFTLPQQPNQKFHLSYTDKERYKNEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAMCVLKMDHHCPWVNNCIGFSNYKFFLQFLAYSVLYCLYIATTVFSYFIKYWRGELPSVRSKFHVLFLLFVACMFFVSLVILFGYHCWLVSRNKTTLEAFCTPVFTSGPEKNGFNLGFIKNIQQVFGDNKKFWLIPIGSSPGDGHSFPMRSMNESQNPLLANEEPWEDNEDDSRDYPEGSSSLAVESET |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC domain containing 15
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IEA:Ensembl | C | Golgi apparatus |
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016409 | IDA:MGI | F | palmitoyltransferase activity |
GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0045184 | IDA:MGI | P | establishment of protein localization |
GO:0018345 | IDA:MGI | P | protein palmitoylation |
GO:0016188 | IMP:MGI | P | synaptic vesicle maturation |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Gene Name
zinc finger, DHHC domain containing 15
Protein Entry
ZDH15_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
Domain | The DHHC domain is required for palmitoyltransferase activity. |
Enzyme Regulation | Inhibited by 2-bromopalmitate. {ECO:0000269|PubMed:15603741}. |
Function | Palmitoyltransferase specific for GAP43 and DLG4/PSD95. {ECO:0000269|PubMed:15603741}. |
Ptm | Autopalmitoylated. |
Similarity | Belongs to the DHHC palmitoyltransferase family. {ECO:0000305}. |
Similarity | Contains 1 DHHC-type zinc finger. {ECO:0000255|PROSITE-ProRule:PRU00067}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Tissue Specificity | Expressed mainly in brain. {ECO:0000269|PubMed:15603741}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002936 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
30425060 | RefSeq | NP_780567 | 337 | palmitoyltransferase ZDHHC15 |
Identical Sequences to LMP002936 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30425060 | DBBJ | BAC26317.1 | 337 | unnamed protein product [Mus musculus] |
GI:30425060 | DBBJ | BAC37081.1 | 337 | unnamed protein product [Mus musculus] |
GI:30425060 | DBBJ | BAE35757.1 | 337 | unnamed protein product [Mus musculus] |
GI:30425060 | GenBank | AAI46424.1 | 337 | Zinc finger, DHHC domain containing 15, partial [synthetic construct] |
GI:30425060 | GenBank | AAI48859.1 | 337 | Zinc finger, DHHC domain containing 15 [synthetic construct] |
GI:30425060 | SwissProt | Q8BGJ0.1 | 337 | RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Mus musculus] |
Related Sequences to LMP002936 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:30425060 | GenBank | AAX73393.1 | 337 | membrane-associated DHHC15 zinc finger protein [Rattus norvegicus] |
GI:30425060 | RefSeq | NP_001034190.1 | 337 | palmitoyltransferase ZDHHC15 [Rattus norvegicus] |
GI:30425060 | RefSeq | XP_005086588.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 [Mesocricetus auratus] |
GI:30425060 | RefSeq | XP_006257207.1 | 337 | PREDICTED: palmitoyltransferase ZDHHC15 isoform X1 [Rattus norvegicus] |
GI:30425060 | RefSeq | XP_006991626.1 | 338 | PREDICTED: palmitoyltransferase ZDHHC15 [Peromyscus maniculatus bairdii] |
GI:30425060 | SwissProt | Q2TGJ4.1 | 337 | RecName: Full=Palmitoyltransferase ZDHHC15; AltName: Full=Zinc finger DHHC domain-containing protein 15; Short=DHHC-15 [Rattus norvegicus] |