Gene/Proteome Database (LMPD)
LMPD ID
LMP002954
Gene ID
Species
Mus musculus (Mouse)
Gene Name
sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae)
Gene Symbol
Synonyms
A830037K02; A830073K23Rik; Sc5dl
Alternate Names
lathosterol oxidase; C-5 sterol desaturase; lathosterol 5-desaturase; delta(7)-sterol 5-desaturase
Chromosome
9
Map Location
9|9 B
EC Number
1.14.21.6
Proteins
lathosterol oxidase | |
---|---|
Refseq ID | NP_766357 |
Protein GI | 27777693 |
UniProt ID | O88822 |
mRNA ID | NM_172769 |
Length | 299 |
RefSeq Status | VALIDATED |
MDLVLSAADYYFFTPYVYPATWPEDNIIRQTISLLIVTNLGAYILYFFCATLSYYFVYDHSLMKHPQFLKNQVSREIVFTVKSLPWISIPTVSLFLLELRGYSKLYDDIGDFPNGWIHLMVSVVSFLFFTDMLIYWIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQSLPYHIYPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGSFKHPSSFEGKGPHSYVKNMTEKESNSFAENGCKGKKVGNGEFTKNK |
Gene Information
Entrez Gene ID
Gene Name
sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae)
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000248 | IEA:Ensembl | F | C-5 sterol desaturase activity |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0050046 | IEA:UniProtKB-EC | F | lathosterol oxidase activity |
GO:0033490 | IEA:Ensembl | P | cholesterol biosynthetic process via lathosterol |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu00100 | Steroid biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5894006 | Activation of gene expression by SREBF (SREBP) |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Gene Name
sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae)
Protein Entry
SC5D_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 5-alpha-cholest-7-en-3-beta-ol + NAD(P)H + O(2) = cholesta-5,7-dien-3-beta-ol + NAD(P)(+) + 2 H(2)O. |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
Domain | The histidine box domains may contain the active site and/or be involved in metal ion binding. |
Function | Catalyzes a dehydrogenation to introduce C5-6 double bond into lathosterol. |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP002954 (as displayed in Record Overview)
Identical Sequences to LMP002954 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27777693 | DBBJ | BAC31666.1 | 299 | unnamed protein product [Mus musculus] |
GI:27777693 | DBBJ | BAC36944.1 | 299 | unnamed protein product [Mus musculus] |
GI:27777693 | RefSeq | XP_006510316.1 | 299 | PREDICTED: lathosterol oxidase isoform X1 [Mus musculus] |
GI:27777693 | SwissProt | O88822.2 | 299 | RecName: Full=Lathosterol oxidase; AltName: Full=C-5 sterol desaturase; AltName: Full=Delta(7)-sterol 5-desaturase; AltName: Full=Lathosterol 5-desaturase; AltName: Full=Sterol-C5-desaturase [Mus musculus] |
Related Sequences to LMP002954 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:27777693 | DBBJ | BAA33730.1 | 299 | sterol-C5-desaturase [Mus musculus] |
GI:27777693 | DBBJ | BAE32506.1 | 299 | unnamed protein product [Mus musculus] |
GI:27777693 | EMBL | CAE83484.1 | 299 | unnamed protein product [Mus musculus] |
GI:27777693 | GenBank | AAH24132.1 | 299 | Sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae) [Mus musculus] |
GI:27777693 | GenBank | EDL25539.1 | 299 | sterol-C5-desaturase (fungal ERG3, delta-5-desaturase) homolog (S. cerevisae) [Mus musculus] |
GI:27777693 | GenBank | ADA21805.1 | 299 | Sequence 8 from patent US 7608421 |