Gene/Proteome Database (LMPD)
Proteins
retinoic acid receptor responder (tazarotene induced) 1 precursor | |
---|---|
Refseq ID | NP_001158235 |
Protein GI | 258613979 |
UniProt ID | Q8BVL6 |
mRNA ID | NM_001164763 |
Length | 283 |
RefSeq Status | VALIDATED |
MQPRQPPMPALLLSLWLLPSLALAAAVTEPADLEYTEVPRQPAAVGLPRGILQLAARAALHFFNFRAGSPSALRVLATVQEGRAWVNPQEGCEVDLVFSTEQYNPEQEGERLGKCSARVFFKNEKPRPAVNVTCARLFDKVKRQEKDYRLYKQMKQLKTPLHSISIPDSHGHIDNSLRPLWDLAFLGSSYVMWEKTTQVLHYYLVQLSSVERLKTDDDSIDFDFTVLLHEFSTQEIIPCRIHLVWYPGKPLKVNYHCQEQQSPEEASGTMEASAMAPPEFGNF | |
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2657 peptide sequence: MQPRQPPMPALLLSLWLLPSLALA |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor responder (tazarotene induced) 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR009684 | Proteinase inhibitor I47, latexin |
UniProt Annotations
Entry Information
Gene Name
retinoic acid receptor responder (tazarotene induced) 1
Protein Entry
J3QNI9_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP002965 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
258613979 | RefSeq | NP_001158235 | 283 | retinoic acid receptor responder (tazarotene induced) 1 precursor |
Identical Sequences to LMP002965 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP002965 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:258613979 | DBBJ | BAC36780.1 | 319 | unnamed protein product, partial [Mus musculus] |
GI:258613979 | GenBank | AAX39430.1 | 284 | tazarotene-induced protein 1 [Rattus norvegicus] |
GI:258613979 | GenBank | AAI05632.1 | 284 | Retinoic acid receptor responder (tazarotene induced) 1 [Rattus norvegicus] |
GI:258613979 | GenBank | EDL15515.1 | 345 | mCG4346 [Mus musculus] |
GI:258613979 | GenBank | EDM00922.1 | 284 | retinoic acid receptor responder (tazarotene induced) 1 [Rattus norvegicus] |
GI:258613979 | RefSeq | NP_001014790.1 | 284 | retinoic acid receptor responder protein 1 precursor [Rattus norvegicus] |