Gene/Proteome Database (LMPD)
LMPD ID
LMP003037
Gene ID
Species
Mus musculus (Mouse)
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Synonyms
4930533H01Rik; AW411817; D11Ertd498e
Alternate Names
WD repeat domain phosphoinositide-interacting protein 1; WIPI-1; WIPI 49 kDa; WD40 repeat protein Interacting with phosphoInositides of 49kDa; WD40 repeat protein interacting with phosphoinositides of 49 kDa
Chromosome
11
Map Location
11 E1|11 72.18 cM
Proteins
| WD repeat domain phosphoinositide-interacting protein 1 | |
|---|---|
| Refseq ID | NP_666052 |
| Protein GI | 22122367 |
| UniProt ID | Q8R3E3 |
| mRNA ID | NM_145940 |
| Length | 446 |
| RefSeq Status | PROVISIONAL |
| MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQSTGEIVLYDGNSLKTVCTIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGKMFMAATNYLPAQVSDMMNQDRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYIYNLDPQDGGECVLIKTHSLLSSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGSQKGKTKQS | |
Gene Information
Entrez Gene ID
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000421 | IEA:Ensembl | C | autophagic vacuole membrane |
| GO:0031410 | IEA:UniProtKB-KW | C | cytoplasmic vesicle |
| GO:0005856 | IEA:UniProtKB-KW | C | cytoskeleton |
| GO:0010008 | IEA:Ensembl | C | endosome membrane |
| GO:0034045 | IEA:Ensembl | C | pre-autophagosomal structure membrane |
| GO:0005802 | IEA:Ensembl | C | trans-Golgi network |
| GO:0080025 | IEA:Ensembl | F | phosphatidylinositol-3,5-bisphosphate binding |
| GO:0032266 | IEA:Ensembl | F | phosphatidylinositol-3-phosphate binding |
| GO:0006914 | IEA:UniProtKB-KW | P | autophagy |
| GO:0048203 | IEA:Ensembl | P | vesicle targeting, trans-Golgi to endosome |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
WD repeat domain, phosphoinositide interacting 1
Protein Entry
WIPI1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8R3E3-1; Sequence=Displayed; Name=2; IsoId=Q8R3E3-2; Sequence=VSP_016969; Name=3; IsoId=Q8R3E3-3; Sequence=VSP_016967, VSP_016968; Note=No experimental confirmation available.; |
| Domain | The N-terminus might form a beta-propeller domain involved in specific binding to phosphatidylinositol 3,5-bisphosphate (PIP2), leading to the association of the protein to the membrane. Association to the membrane can also occur through binding to phosphatidylinositol 3-monophosphate (PI3P). |
| Function | Plays an important role in autophagy and in particular starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions upstream of the ATG12-ATG5-ATG16L1 complex and LC3, and downstream of the ULK1 and PI3-kinase complexes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Plays also a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation- induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway. {ECO:0000269|PubMed:22275429}. |
| Sequence Caution | Sequence=AAH24811.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=AAH24883.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; |
| Similarity | Belongs to the WD repeat SVP1 family. {ECO:0000305}. |
| Similarity | Contains 3 WD repeats. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus, trans-Golgi network {ECO:0000250}. Endosome {ECO:0000250}. Cytoplasmic vesicle, clathrin-coated vesicle {ECO:0000250}. Preautophagosomal structure membrane {ECO:0000269|PubMed:21896713}; Peripheral membrane protein {ECO:0000269|PubMed:21896713}. Cytoplasm, cytoskeleton {ECO:0000250}. Note=Trans elements of the Golgi and peripheral endosomes. Dynamically cycles through these compartments and is susceptible to conditions that modulate membrane flux. Enriched in clathrin-coated vesicles. Upon starvation-induced autophagy, accumulates at subcellular structures in the cytoplasm: enlarged vesicular and lasso-like structures, and large cup-shaped structures predominantly around the nucleus. Recruitment to autophagic membranes is controlled by MTMR14. Labile microtubules specifically recruit markers of autophagosome formation like WIPI1, whereas mature autophagosomes may bind to stable microtubules (By similarity). {ECO:0000250}. |
| Subunit | Interacts with androgen receptor (AR) and the estrogen receptors ESR1 and ESR2. Binds PtdIns3P and to a lesser extent, PtdIns3,5P2 and PtdIns5P in vitro. Interaction with PtdIns3P is required for recruitment to membranes. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003037 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 22122367 | RefSeq | NP_666052 | 446 | WD repeat domain phosphoinositide-interacting protein 1 |
Identical Sequences to LMP003037 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22122367 | DBBJ | BAE35227.1 | 446 | unnamed protein product [Mus musculus] |
| GI:22122367 | DBBJ | BAE41884.1 | 446 | unnamed protein product [Mus musculus] |
| GI:22122367 | GenBank | AAH25560.1 | 446 | WD repeat domain, phosphoinositide interacting 1 [Mus musculus] |
| GI:22122367 | GenBank | EDL34365.1 | 446 | WD repeat domain, phosphoinositide interacting 1, isoform CRA_c [Mus musculus] |
| GI:22122367 | SwissProt | Q8R3E3.1 | 446 | RecName: Full=WD repeat domain phosphoinositide-interacting protein 1; Short=WIPI-1; AltName: Full=WD40 repeat protein interacting with phosphoinositides of 49 kDa; Short=WIPI 49 kDa [Mus musculus] |
Related Sequences to LMP003037 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:22122367 | GenBank | AAI66829.1 | 446 | Wipi1 protein [Rattus norvegicus] |
| GI:22122367 | RefSeq | NP_001120769.1 | 446 | WD repeat domain phosphoinositide-interacting protein 1 [Rattus norvegicus] |
| GI:22122367 | RefSeq | XP_005070033.1 | 446 | PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 isoform X1 [Mesocricetus auratus] |
| GI:22122367 | RefSeq | XP_005350714.1 | 446 | PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 [Microtus ochrogaster] |
| GI:22122367 | RefSeq | XP_006970528.1 | 446 | PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 [Peromyscus maniculatus bairdii] |
| GI:22122367 | RefSeq | XP_003500367.2 | 446 | PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 isoform X1 [Cricetulus griseus] |