Gene/Proteome Database (LMPD)

LMPD ID
LMP003037
Gene ID
Species
Mus musculus (Mouse)
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Synonyms
4930533H01Rik; AW411817; D11Ertd498e
Alternate Names
WD repeat domain phosphoinositide-interacting protein 1; WIPI-1; WIPI 49 kDa; WD40 repeat protein Interacting with phosphoInositides of 49kDa; WD40 repeat protein interacting with phosphoinositides of 49 kDa
Chromosome
11
Map Location
11 E1|11 72.18 cM

Proteins

WD repeat domain phosphoinositide-interacting protein 1
Refseq ID NP_666052
Protein GI 22122367
UniProt ID Q8R3E3
mRNA ID NM_145940
Length 446
RefSeq Status PROVISIONAL
MEAEAADAPPGRVEAALSCFSFNQDCTSLAIGTKAGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMNVYHFKKGTEICNYSYSSNILSIRLNRQRLLVCLEESIYIHNIKDMKLLKTVLDIPSNPTGLCALSINHSNSYLAYPGSQSTGEIVLYDGNSLKTVCTIAAHEGTLAAITFNSSGSKLASASEKGTVIRVFSVPEGQKLYEFRRGMKRYVTISSLVFSMDSQFLCASSNTETVHIFKMEHLTDSRPEEPSTWSGYMGKMFMAATNYLPAQVSDMMNQDRAFATGRLNFSGQKNICTLSTIQKLPRLLVASSDGHLYIYNLDPQDGGECVLIKTHSLLSSGTTEENKENDLRPSLPPSYAATVARPSTSAASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGSQKGKTKQS

Gene Information

Entrez Gene ID
Gene Name
WD repeat domain, phosphoinositide interacting 1
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000421 IEA:Ensembl C autophagic vacuole membrane
GO:0031410 IEA:UniProtKB-KW C cytoplasmic vesicle
GO:0005856 IEA:UniProtKB-KW C cytoskeleton
GO:0010008 IEA:Ensembl C endosome membrane
GO:0034045 IEA:Ensembl C pre-autophagosomal structure membrane
GO:0005802 IEA:Ensembl C trans-Golgi network
GO:0080025 IEA:Ensembl F phosphatidylinositol-3,5-bisphosphate binding
GO:0032266 IEA:Ensembl F phosphatidylinositol-3-phosphate binding
GO:0006914 IEA:UniProtKB-KW P autophagy
GO:0048203 IEA:Ensembl P vesicle targeting, trans-Golgi to endosome

REACTOME Pathway Links

REACTOME Pathway ID Description
5893676 IRE1alpha activates chaperones
5892855 Metabolism of proteins
5893674 Unfolded Protein Response (UPR)
5894015 XBP1(S) activates chaperone genes

Domain Information

InterPro Annotations

Accession Description
IPR017986 WD40-repeat-containing domain
IPR015943 WD40/YVTN repeat-like-containing domain
IPR001680 WD40_repeat

UniProt Annotations

Entry Information

Gene Name
WD repeat domain, phosphoinositide interacting 1
Protein Entry
WIPI1_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q8R3E3-1; Sequence=Displayed; Name=2; IsoId=Q8R3E3-2; Sequence=VSP_016969; Name=3; IsoId=Q8R3E3-3; Sequence=VSP_016967, VSP_016968; Note=No experimental confirmation available.;
Domain The N-terminus might form a beta-propeller domain involved in specific binding to phosphatidylinositol 3,5-bisphosphate (PIP2), leading to the association of the protein to the membrane. Association to the membrane can also occur through binding to phosphatidylinositol 3-monophosphate (PI3P).
Function Plays an important role in autophagy and in particular starvation- and calcium-mediated autophagy, as well as in mitophagy. Functions upstream of the ATG12-ATG5-ATG16L1 complex and LC3, and downstream of the ULK1 and PI3-kinase complexes. Involved in xenophagy of Staphylococcus aureus. Invading S.aureus cells become entrapped in autophagosome-like WIPI1 positive vesicles targeted for lysosomal degradation. Plays also a distinct role in controlling the transcription of melanogenic enzymes and melanosome maturation, a process that is distinct from starvation- induced autophagy. May also regulate the trafficking of proteins involved in the mannose-6-phosphate receptor (MPR) recycling pathway. {ECO:0000269|PubMed:22275429}.
Sequence Caution Sequence=AAH24811.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=AAH24883.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Belongs to the WD repeat SVP1 family. {ECO:0000305}.
Similarity Contains 3 WD repeats. {ECO:0000305}.
Subcellular Location Golgi apparatus, trans-Golgi network {ECO:0000250}. Endosome {ECO:0000250}. Cytoplasmic vesicle, clathrin-coated vesicle {ECO:0000250}. Preautophagosomal structure membrane {ECO:0000269|PubMed:21896713}; Peripheral membrane protein {ECO:0000269|PubMed:21896713}. Cytoplasm, cytoskeleton {ECO:0000250}. Note=Trans elements of the Golgi and peripheral endosomes. Dynamically cycles through these compartments and is susceptible to conditions that modulate membrane flux. Enriched in clathrin-coated vesicles. Upon starvation-induced autophagy, accumulates at subcellular structures in the cytoplasm: enlarged vesicular and lasso-like structures, and large cup-shaped structures predominantly around the nucleus. Recruitment to autophagic membranes is controlled by MTMR14. Labile microtubules specifically recruit markers of autophagosome formation like WIPI1, whereas mature autophagosomes may bind to stable microtubules (By similarity). {ECO:0000250}.
Subunit Interacts with androgen receptor (AR) and the estrogen receptors ESR1 and ESR2. Binds PtdIns3P and to a lesser extent, PtdIns3,5P2 and PtdIns5P in vitro. Interaction with PtdIns3P is required for recruitment to membranes. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003037 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
22122367 RefSeq NP_666052 446 WD repeat domain phosphoinositide-interacting protein 1

Identical Sequences to LMP003037 proteins

Reference Database Accession Length Protein Name
GI:22122367 DBBJ BAE35227.1 446 unnamed protein product [Mus musculus]
GI:22122367 DBBJ BAE41884.1 446 unnamed protein product [Mus musculus]
GI:22122367 GenBank AAH25560.1 446 WD repeat domain, phosphoinositide interacting 1 [Mus musculus]
GI:22122367 GenBank EDL34365.1 446 WD repeat domain, phosphoinositide interacting 1, isoform CRA_c [Mus musculus]
GI:22122367 SwissProt Q8R3E3.1 446 RecName: Full=WD repeat domain phosphoinositide-interacting protein 1; Short=WIPI-1; AltName: Full=WD40 repeat protein interacting with phosphoinositides of 49 kDa; Short=WIPI 49 kDa [Mus musculus]

Related Sequences to LMP003037 proteins

Reference Database Accession Length Protein Name
GI:22122367 GenBank AAI66829.1 446 Wipi1 protein [Rattus norvegicus]
GI:22122367 RefSeq NP_001120769.1 446 WD repeat domain phosphoinositide-interacting protein 1 [Rattus norvegicus]
GI:22122367 RefSeq XP_005070033.1 446 PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 isoform X1 [Mesocricetus auratus]
GI:22122367 RefSeq XP_005350714.1 446 PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 [Microtus ochrogaster]
GI:22122367 RefSeq XP_006970528.1 446 PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 [Peromyscus maniculatus bairdii]
GI:22122367 RefSeq XP_003500367.2 446 PREDICTED: WD repeat domain phosphoinositide-interacting protein 1 isoform X1 [Cricetulus griseus]