Gene/Proteome Database (LMPD)

LMPD ID
LMP003140
Gene ID
13135
Species
Mus musculus (Mouse)
Gene Name
defender against cell death 1
Gene Symbol
Dad1
Synonyms
AI323713
Alternate Names
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; DAD-1; oligosaccharyl transferase subunit DAD1
Chromosome
14
Map Location
14 C2|14 27.7 cM
EC Number
2.4.99.18

Proteins

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Refseq ID NP_001106829
Protein GI 164518942
UniProt ID P61804
mRNA ID NM_001113358
Length 113
RefSeq Status VALIDATED
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Refseq ID NP_034145
Protein GI 6753598
UniProt ID P61804
mRNA ID NM_010015
Length 113
RefSeq Status VALIDATED
Protein sequence is identical to GI:164518942 (mRNA isoform)

Gene Information

Entrez Gene ID
13135
Gene Name
defender against cell death 1
Gene Symbol
Dad1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008250 ISS:UniProtKB C oligosaccharyltransferase complex
GO:0004579 IEA:InterPro F dolichyl-diphosphooligosaccharide-protein glycotransferase activity
GO:0006915 IEA:UniProtKB-KW P apoptotic process
GO:0001824 IMP:MGI P blastocyst development
GO:0043066 IMP:MGI P negative regulation of apoptotic process
GO:0006486 ISS:UniProtKB P protein glycosylation
GO:0042493 IEA:Ensembl P response to drug
GO:0007584 IEA:Ensembl P response to nutrient

KEGG Pathway Links

KEGG Pathway ID Description
mmu00510 N-Glycan biosynthesis
ko04141 Protein processing in endoplasmic reticulum
mmu04141 Protein processing in endoplasmic reticulum

Domain Information

InterPro Annotations

Accession Description
IPR003038 DAD/Ost2

UniProt Annotations

Entry Information

Gene Name
defender against cell death 1
Protein Entry
DAD1_MOUSE
UniProt ID
P61804
Species
Mouse

Comments

Comment Type Description
Catalytic Activity Dolichyl diphosphooligosaccharide + [protein]- L-asparagine = dolichyl diphosphate + a glycoprotein with the oligosaccharide chain attached by N-beta-D-glycosyl linkage to a protein L-asparagine.
Function Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) (By similarity). Loss of the DAD1 protein triggers apoptosis. {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the DAD/OST2 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}.
Subunit Component of the oligosaccharyltransferase (OST) complex. OST seems to exist in different forms which contain at least RPN1, RPN2, OST48, DAD1, OSTC, KRTCAP2 and either STT3A or STT3B. OST can form stable complexes with the Sec61 complex or with both the Sec61 and TRAP complexes (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003140 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
164518942 RefSeq NP_001106829 113 dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1

Identical Sequences to LMP003140 proteins

Reference Database Accession Length Protein Name
GI:164518942 RefSeq XP_008063474.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Tarsius syrichta]
GI:164518942 RefSeq XP_008533453.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Equus przewalskii]
GI:164518942 RefSeq XP_008588297.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 isoform X2 [Galeopterus variegatus]
GI:164518942 RefSeq XP_008708740.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Ursus maritimus]
GI:164518942 RefSeq XP_008838140.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Nannospalax galili]
GI:164518942 RefSeq XP_010376647.1 113 PREDICTED: dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 [Rhinopithecus roxellana]

Related Sequences to LMP003140 proteins

Reference Database Accession Length Protein Name
GI:164518942 GenBank AAP36473.1 114 Homo sapiens defender against cell death 1, partial [synthetic construct]
GI:164518942 GenBank AAX29139.1 114 defender against cell death 1, partial [synthetic construct]
GI:164518942 GenBank AAX29140.1 114 defender against cell death 1, partial [synthetic construct]
GI:164518942 GenBank AAX29787.1 114 defender against cell death 1, partial [synthetic construct]
GI:164518942 GenBank AAX36954.1 114 defender against cell death 1, partial [synthetic construct]
GI:164518942 GenBank ACM85253.1 135 Sequence 10751 from patent US 6812339