Gene/Proteome Database (LMPD)

LMPD ID
LMP003160
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Gene Symbol
Synonyms
DPPL2; PPAPDC1
Alternate Names
phosphatidate phosphatase PPAPDC1A; diacylglycerol pyrophosphate like 2; phosphatidic acid phosphatase type 2 domain-containing protein 1A
Chromosome
10
Map Location
10q26.12
EC Number
3.1.3.4

Proteins

phosphatidate phosphatase PPAPDC1A
Refseq ID NP_001025230
Protein GI 73611920
UniProt ID Q5VZY2
mRNA ID NM_001030059
Length 271
RefSeq Status VALIDATED
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLTPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV

Gene Information

Entrez Gene ID
Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0008195 IDA:UniProtKB F phosphatidate phosphatase activity
GO:0038096 TAS:Reactome P Fc-gamma receptor signaling pathway involved in phagocytosis
GO:0045087 TAS:Reactome P innate immune response
GO:0046839 IDA:UniProtKB P phospholipid dephosphorylation

BIOCYC Pathway Links

BIOCYC Pathway ID Description
TRIGLSYN-PWY triacylglycerol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_160123 Fcgamma receptor (FCGR) dependent phagocytosis
REACT_6802 Innate Immune System
REACT_160158 Role of phospholipids in phagocytosis

Domain Information

InterPro Annotations

Accession Description
IPR028668 Phosphatidate phosphatase PPAPDC1A/PPAPDC1B
IPR000326 Phosphatidic acid phosphatase type 2/haloperoxidase

UniProt Annotations

Entry Information

Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Protein Entry
PPC1A_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q5VZY2-1; Sequence=Displayed; Name=2; IsoId=Q5VZY2-2; Sequence=VSP_025238; Note=No experimental confirmation available.; Name=3; IsoId=Q5VZY2-3; Sequence=VSP_025237; Note=No experimental confirmation available.; Name=4; IsoId=Q5VZY2-4; Sequence=VSP_025239, VSP_025240; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=104 uM for diacylglycerol pyrophosphate ; KM=506 uM for phosphatidate ; KM=580 uM for lysophosphatidate ;
Catalytic Activity A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate.
Enzyme Regulation Inhibited by N-ethylmaleimide.
Function Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.
Sequence Caution Sequence=CAH70333.1; Type=Erroneous gene model prediction; Evidence= ;
Similarity Belongs to the PA-phosphatase related phosphoesterase family.
Subcellular Location Membrane ; Multi-pass membrane protein .
Tissue Specificity Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus.

Identical and Related Proteins

Unique RefSeq proteins for LMP003160 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
73611920 RefSeq NP_001025230 271 phosphatidate phosphatase PPAPDC1A

Identical Sequences to LMP003160 proteins

Reference Database Accession Length Protein Name
GI:73611920 GenBank JAA00595.1 271 phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes]
GI:73611920 GenBank JAA18770.1 271 phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes]
GI:73611920 GenBank JAA30244.1 271 phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes]
GI:73611920 GenBank JAA34634.1 271 phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes]
GI:73611920 GenBank AIC53355.1 271 PPAPDC1A, partial [synthetic construct]
GI:73611920 RefSeq XP_005566644.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Macaca fascicularis]

Related Sequences to LMP003160 proteins

Reference Database Accession Length Protein Name
GI:73611920 RefSeq NP_001178560.1 271 phosphatidate phosphatase PPAPDC1A [Rattus norvegicus]
GI:73611920 RefSeq XP_005320785.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Ictidomys tridecemlineatus]
GI:73611920 RefSeq XP_006144021.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A [Tupaia chinensis]
GI:73611920 RefSeq XP_006977053.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A [Peromyscus maniculatus bairdii]
GI:73611920 RefSeq XP_007962459.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Chlorocebus sabaeus]
GI:73611920 RefSeq XP_010363972.1 271 PREDICTED: phosphatidate phosphatase PPAPDC1A [Rhinopithecus roxellana]