Gene/Proteome Database (LMPD)
LMPD ID
LMP003160
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Gene Symbol
Synonyms
DPPL2; PPAPDC1
Alternate Names
phosphatidate phosphatase PPAPDC1A; diacylglycerol pyrophosphate like 2; phosphatidic acid phosphatase type 2 domain-containing protein 1A
Chromosome
10
Map Location
10q26.12
EC Number
3.1.3.4
Proteins
phosphatidate phosphatase PPAPDC1A | |
---|---|
Refseq ID | NP_001025230 |
Protein GI | 73611920 |
UniProt ID | Q5VZY2 |
mRNA ID | NM_001030059 |
Length | 271 |
RefSeq Status | VALIDATED |
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFLTPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGVMNSEMHCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLCAAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVSLRVPASLKKEERPTADSAPSLPLEGITEGPV |
Gene Information
Entrez Gene ID
Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | TAS:Reactome | C | plasma membrane |
GO:0008195 | IDA:UniProtKB | F | phosphatidate phosphatase activity |
GO:0038096 | TAS:Reactome | P | Fc-gamma receptor signaling pathway involved in phagocytosis |
GO:0045087 | TAS:Reactome | P | innate immune response |
GO:0046839 | IDA:UniProtKB | P | phospholipid dephosphorylation |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
TRIGLSYN-PWY | triacylglycerol biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_160123 | Fcgamma receptor (FCGR) dependent phagocytosis |
REACT_6802 | Innate Immune System |
REACT_160158 | Role of phospholipids in phagocytosis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
phosphatidic acid phosphatase type 2 domain containing 1A
Protein Entry
PPC1A_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=4; Name=1; IsoId=Q5VZY2-1; Sequence=Displayed; Name=2; IsoId=Q5VZY2-2; Sequence=VSP_025238; Note=No experimental confirmation available.; Name=3; IsoId=Q5VZY2-3; Sequence=VSP_025237; Note=No experimental confirmation available.; Name=4; IsoId=Q5VZY2-4; Sequence=VSP_025239, VSP_025240; Note=No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: KM=104 uM for diacylglycerol pyrophosphate ; KM=506 uM for phosphatidate ; KM=580 uM for lysophosphatidate ; |
Catalytic Activity | A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate. |
Enzyme Regulation | Inhibited by N-ethylmaleimide. |
Function | Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol. |
Sequence Caution | Sequence=CAH70333.1; Type=Erroneous gene model prediction; Evidence= ; |
Similarity | Belongs to the PA-phosphatase related phosphoesterase family. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Tissue Specificity | Expressed mainly to the brain, kidney and testis, and to a lesser extent the bone marrow, thymus, prostate, liver and uterus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003160 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
73611920 | RefSeq | NP_001025230 | 271 | phosphatidate phosphatase PPAPDC1A |
Identical Sequences to LMP003160 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:73611920 | GenBank | JAA00595.1 | 271 | phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes] |
GI:73611920 | GenBank | JAA18770.1 | 271 | phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes] |
GI:73611920 | GenBank | JAA30244.1 | 271 | phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes] |
GI:73611920 | GenBank | JAA34634.1 | 271 | phosphatidic acid phosphatase type 2 domain containing 1A [Pan troglodytes] |
GI:73611920 | GenBank | AIC53355.1 | 271 | PPAPDC1A, partial [synthetic construct] |
GI:73611920 | RefSeq | XP_005566644.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Macaca fascicularis] |
Related Sequences to LMP003160 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:73611920 | RefSeq | NP_001178560.1 | 271 | phosphatidate phosphatase PPAPDC1A [Rattus norvegicus] |
GI:73611920 | RefSeq | XP_005320785.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Ictidomys tridecemlineatus] |
GI:73611920 | RefSeq | XP_006144021.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A [Tupaia chinensis] |
GI:73611920 | RefSeq | XP_006977053.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A [Peromyscus maniculatus bairdii] |
GI:73611920 | RefSeq | XP_007962459.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A isoform X1 [Chlorocebus sabaeus] |
GI:73611920 | RefSeq | XP_010363972.1 | 271 | PREDICTED: phosphatidate phosphatase PPAPDC1A [Rhinopithecus roxellana] |