Gene/Proteome Database (LMPD)
Proteins
| sialidase-4 | |
|---|---|
| Refseq ID | NP_776133 |
| Protein GI | 30424629 |
| UniProt ID | Q8BZL1 |
| mRNA ID | NM_173772 |
| Length | 478 |
| RefSeq Status | VALIDATED |
| MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005764 | ISS:UniProtKB | C | lysosome |
| GO:0005739 | IDA:MGI | C | mitochondrion |
| GO:0019866 | ISS:UniProtKB | C | organelle inner membrane |
| GO:0052794 | IEA:UniProtKB-EC | F | exo-alpha-(2->3)-sialidase activity |
| GO:0052795 | IEA:UniProtKB-EC | F | exo-alpha-(2->6)-sialidase activity |
| GO:0052796 | IEA:UniProtKB-EC | F | exo-alpha-(2->8)-sialidase activity |
| GO:0004308 | IDA:MGI | F | exo-alpha-sialidase activity |
| GO:0006689 | ISS:UniProtKB | P | ganglioside catabolic process |
| GO:0006516 | ISS:UniProtKB | P | glycoprotein catabolic process |
| GO:0009313 | ISS:UniProtKB | P | oligosaccharide catabolic process |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q8BZL1-2; Sequence=Displayed; Name=2; IsoId=Q8BZL1-1; Sequence=VSP_037492; Note=No experimental confirmation available.; |
| Catalytic Activity | Hydrolysis of alpha-(2->3)-, alpha-(2->6)-, alpha-(2->8)- glycosidic linkages of terminal sialic acid residues in oligosaccharides, glycoproteins, glycolipids, colominic acid and synthetic substrates. |
| Function | May function in lysosomal catabolism of sialylated glycoconjugates. Has sialidase activity towards synthetic substrates, such as 2'-(4-methylumbelliferyl)-alpha-D-N- acetylneuraminic acid (4-MU-NANA or 4MU-NeuAc). Has a broad substrate specificity being active on glycoproteins, oligosaccharides and sialylated glycolipids (By similarity). {ECO:0000250}. |
| Similarity | Belongs to the glycosyl hydrolase 33 family. {ECO:0000305}. |
| Similarity | Contains 3 BNR repeats. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000250}; Peripheral membrane protein {ECO:0000250}. |
| Tissue Specificity | Expressed predominantly in brain. {ECO:0000269|PubMed:14637003}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003225 (as displayed in Record Overview)
Identical Sequences to LMP003225 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30424629 | DBBJ | BAC28641.1 | 478 | unnamed protein product [Mus musculus] |
| GI:30424629 | GenBank | AAH70438.1 | 478 | Sialidase 4 [Mus musculus] |
| GI:30424629 | GenBank | EDL39923.1 | 478 | sialidase 4 [Mus musculus] |
| GI:30424629 | SwissProt | Q8BZL1.3 | 478 | RecName: Full=Sialidase-4; AltName: Full=N-acetyl-alpha-neuraminidase 4; AltName: Full=Neuraminidase 4 [Mus musculus] |
Related Sequences to LMP003225 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30424629 | DBBJ | BAH79965.1 | 501 | sialidase 4 [Mus musculus] |
| GI:30424629 | GenBank | AAP81169.1 | 501 | neuraminidase 4 [Mus musculus] |
| GI:30424629 | RefSeq | NP_001101704.1 | 478 | sialidase-4 [Rattus norvegicus] |
| GI:30424629 | RefSeq | XP_006245597.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |
| GI:30424629 | RefSeq | XP_006529656.1 | 501 | PREDICTED: sialidase-4 isoform X1 [Mus musculus] |
| GI:30424629 | RefSeq | XP_008765598.1 | 505 | PREDICTED: sialidase-4 isoform X1 [Rattus norvegicus] |