Gene/Proteome Database (LMPD)

LMPD ID
LMP003229
Gene ID
170685
Species
Homo sapiens (Human)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Gene Symbol
NUDT10
Synonyms
APS2; DIPP3a; hDIPP3alpha
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 3-alpha; hAps2; DIPP3-alpha; DIPP-3-alpha; nudix motif 10; nucleoside diphosphate-linked moiety X motif 10; diadenosine hexaphosphate hydrolase (AMP-forming)', "diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 3-alpha;,diphosphoinositol polyphosphate phosphohydrolase type 3 alpha
Chromosome
X
Map Location
Xp11.23
EC Number
3.6.1.52
Summary
NUDT10 belongs to a subgroup of phosphohydrolases that preferentially attack diphosphoinositol polyphosphates (Hidaka et al., 2002 [PubMed 12105228]).[supplied by OMIM, Mar 2008]
Orthologs
View orthologs and multiple alignments for NUDT10

Proteins

diphosphoinositol polyphosphate phosphohydrolase 3-alpha
Refseq ID NP_694853
Protein GI 41393549
UniProt ID Q8NFP7
mRNA ID NM_153183
Length 164
RefSeq Status PROVISIONAL
MKCKPNQTRTYDPEGFKKRAACLCFRSEREDEVLLVSSSRYPDRWIVPGGGMEPEEEPGGAAVREVYEEAGVKGKLGRLLGVFEQNQDPKHRTYVYVLTVTELLEDWEDSVSIGRKREWFKVEDAIKVLQCHKPVHAEYLEKLKLGGSPTNGNSMAPSSPDSDP

Gene Information

Entrez Gene ID
170685
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Gene Symbol
NUDT10
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0008486 ISS:UniProtKB F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052840 IEA:UniProtKB-EC F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0043647 TAS:Reactome P inositol phosphate metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150154 Inositol phosphate metabolism
REACT_111217 Metabolism
REACT_150188 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like
IPR020084 NUDIX hydrolase, conserved site

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 10
Protein Entry
NUD10_HUMAN
UniProt ID
Q8NFP7
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.088 uM for PP-InsP5 {ECO
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate.
Catalytic Activity P(1),P(5)-bis(5'-adenosyl)pentaphosphate + H(2)O = adenosine 5'-tetraphosphate + AMP.
Catalytic Activity P(1),P(6)-bis(5'-adenosyl)hexaphosphate + H(2)O = adenosine 5'-pentaphosphate + AMP.
Cofactor Name=Mg(2+); Xref=ChEBI
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate), suggesting that it may play a role in signal transduction. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5-phosphoribose 1-diphosphate.
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily.
Similarity Contains 1 nudix hydrolase domain.
Subcellular Location Cytoplasm .
Tissue Specificity Mainly expressed in testis and, at lower level in brain. According to PubMed:12121577, it is widely expressed.

Identical and Related Proteins

Unique RefSeq proteins for LMP003229 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41393549 RefSeq NP_694853 164 diphosphoinositol polyphosphate phosphohydrolase 3-alpha

Identical Sequences to LMP003229 proteins

Reference Database Accession Length Protein Name
GI:41393549 DBBJ BAF84641.1 164 unnamed protein product [Homo sapiens]
GI:41393549 GenBank EAW89911.1 164 nudix (nucleoside diphosphate linked moiety X)-type motif 10, isoform CRA_a [Homo sapiens]
GI:41393549 GenBank EHH60898.1 164 Diphosphoinositol polyphosphate phosphohydrolase 3-beta [Macaca fascicularis]
GI:41393549 RefSeq XP_003276913.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform 1 [Nomascus leucogenys]
GI:41393549 RefSeq XP_003276914.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform 2 [Nomascus leucogenys]
GI:41393549 RefSeq XP_005262099.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Homo sapiens]

Related Sequences to LMP003229 proteins

Reference Database Accession Length Protein Name
GI:41393549 GenBank AAH49383.1 164 Nudix (nucleoside diphosphate linked moiety X)-type motif 10 [Homo sapiens]
GI:41393549 GenBank ADQ33055.1 164 nudix (nucleoside diphosphate linked moiety X)-type motif 10, partial [synthetic construct]
GI:41393549 GenBank AIC57922.1 164 NUDT10, partial [synthetic construct]
GI:41393549 RefSeq XP_005593655.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X1 [Macaca fascicularis]
GI:41393549 RefSeq XP_005593656.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X2 [Macaca fascicularis]
GI:41393549 RefSeq XP_005593657.1 164 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 3-alpha isoform X3 [Macaca fascicularis]