Gene/Proteome Database (LMPD)
Proteins
| retinoic acid receptor responder protein 2 precursor | |
|---|---|
| Refseq ID | NP_082128 |
| Protein GI | 21313658 |
| UniProt ID | Q9DD06 |
| mRNA ID | NM_027852 |
| Length | 162 |
| RefSeq Status | PROVISIONAL |
| MKCLLISLALWLGTVGTRGTEPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFSRALRTK | |
| sig_peptide: 1..20 inference: non-experimental evidence, no additional details recorded note: By similarity; propagated from UniProtKB/Swiss-Prot (Q9DD06.1) calculated_mol_wt: 2134 peptide sequence: MKCLLISLALWLGTVGTRGT mat_peptide: 21..156 product: Retinoic acid receptor responder protein 2 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9DD06.1) calculated_mol_wt: 15508 peptide sequence: EPELSETQRRSLQVALEEFHKHPPVQLAFQEIGVDRAEEVLFSAGTFVRLEFKLQQTNCPKKDWKKPECTIKPNGRRRKCLACIKMDPKGKILGRIVHCPILKQGPQDPQELQCIKIAQAGEDPHGYFLPGQFAFS | |
Gene Information
Entrez Gene ID
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031012 | IEA:Ensembl | C | extracellular matrix |
| GO:0005576 | IDA:UniProtKB | C | extracellular region |
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0050873 | IDA:MGI | P | brown fat cell differentiation |
| GO:0006935 | IEA:UniProtKB-KW | P | chemotaxis |
| GO:0048566 | IEA:Ensembl | P | embryonic digestive tract development |
| GO:0006954 | IEA:UniProtKB-KW | P | inflammatory response |
| GO:0001701 | IEA:Ensembl | P | in utero embryonic development |
| GO:0050921 | IDA:UniProtKB | P | positive regulation of chemotaxis |
| GO:0045600 | IMP:UniProtKB | P | positive regulation of fat cell differentiation |
| GO:2001275 | IDA:UniProtKB | P | positive regulation of glucose import in response to insulin stimulus |
| GO:0010759 | IEA:Ensembl | P | positive regulation of macrophage chemotaxis |
| GO:0001934 | IDA:UniProtKB | P | positive regulation of protein phosphorylation |
| GO:0050994 | IMP:UniProtKB | P | regulation of lipid catabolic process |
| GO:0001523 | IEA:Ensembl | P | retinoid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Gene Name
retinoic acid receptor responder (tazarotene induced) 2
Protein Entry
RARR2_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Function | Adipocyte-secreted protein (adipokine) that regulates adipogenesis, metabolism and inflammation through activation of the chemokine-like receptor 1 (CMKLR1). Its other ligands include G protein-coupled receptor 1 (GPR1) and chemokine receptor-like 2 (CCRL2). Positively regulates adipocyte differentiation, modulates the expression of adipocyte genes involved in lipid and glucose metabolism and might play a role in angiogenesis, a process essential for the expansion of white adipose tissue. Also acts as a proinflammatory adipokine, causing an increase in secretion of proinflammatory and prodiabetic adipokines, which further impair adipose tissue metabolic function and have negative systemic effects including impaired insulin sensitivity, altered glucose and lipid metabolism, and a decrease in vascular function in other tissues. Can have both pro- and anti-inflammatory properties depending on the modality of enzymatic cleavage by different classes of proteases. Acts as a chemotactic factor for leukocyte populations expressing CMKLR1, particularly immature plasmacytoid dendritic cells, but also immature myeloid DCs, macrophages and natural killer cells. Exerts an anti-inflammatory role by preventing TNF/TNFA-induced VCAM1 expression and monocytes adhesion in vascular endothelial cells. The effect is mediated via inhibiting activation of NF-kappa-B and CRK/p38 through stimulation of AKT1/NOS3 signaling and nitric oxide production. Exhibits an antimicrobial function in the skin. {ECO:0000269|PubMed:17635925, ECO:0000269|PubMed:18242188}. |
| Induction | Strongly induced during adipocyte differentiation. {ECO:0000269|PubMed:18242188}. |
| Ptm | Secreted in an inactive precursor form, prochemerin, which is proteolytically processed by a variety of extracellular proteases to generate forms with differing levels of bioactivity. For example, the removal of six amino acids results in chemerin-156, which exhibits the highest activity, while removal of seven amino acids results in chemerin-155 which has slightly less activity. Some proteases are able to cleave at more than one site and chemerin forms may be sequentially processed by different enzymes to modulate activity levels. The coordinated expression and activity of chemerin-modifying enzymes is essential for regulating its bioactivation, inactivation and, consequently, biological function. Cathepsin G cleaves seven C-terminal amino acids from prochemerin (chemerin-155), elastase is able to cleave six (chemerin-156), eight (chemerin-154) or eleven (chemerin-151), plasmin cleaves five amino acids (chemerin-157), and tryptase cleaves five (chemerin-157) or eight (chemerin-154). Multiple cleavages might be required to fully activate chemerin, with an initial tryptase cleavage resulting in chemerin with low activity (chemerin-157), and a second cleavage by carboxypeptidase N or B producing highly active chemerin (chemerin-156) (By similarity). {ECO:0000250}. |
| Subcellular Location | Secreted {ECO:0000269|PubMed:17635925, ECO:0000269|PubMed:18242188}. |
| Tissue Specificity | Expressed in the differentiated adipocytes (at protein level). Abundantly expressed in the liver, adipose tissue including visceral, epididymal, and brown adipose tissue. {ECO:0000269|PubMed:17635925, ECO:0000269|PubMed:17767914, ECO:0000269|PubMed:18242188}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003246 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 21313658 | RefSeq | NP_082128 | 162 | retinoic acid receptor responder protein 2 precursor |
Identical Sequences to LMP003246 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313658 | GenBank | ACW49755.1 | 162 | Sequence 10 from patent US 7582734 |
| GI:21313658 | GenBank | ADF13407.1 | 162 | Sequence 10 from patent US 7666401 |
| GI:21313658 | GenBank | ADT46221.1 | 162 | Sequence 10 from patent US 7842453 |
| GI:21313658 | GenBank | AEN51745.1 | 162 | Sequence 10 from patent US 8003347 |
| GI:21313658 | GenBank | AEQ82132.1 | 162 | Sequence 10 from patent US 8030453 |
| GI:21313658 | RefSeq | XP_006506687.1 | 162 | PREDICTED: retinoic acid receptor responder protein 2 isoform X2 [Mus musculus] |
Related Sequences to LMP003246 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:21313658 | GenBank | AAE73612.1 | 147 | Sequence 35 from patent US 6242419 |
| GI:21313658 | GenBank | AAH38914.1 | 162 | Retinoic acid receptor responder (tazarotene induced) 2 [Mus musculus] |
| GI:21313658 | GenBank | AAW05487.1 | 147 | Sequence 35 from patent US 6797271 |
| GI:21313658 | GenBank | EDK98544.1 | 165 | retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_b, partial [Mus musculus] |
| GI:21313658 | GenBank | EDK98545.1 | 161 | retinoic acid receptor responder (tazarotene induced) 2, isoform CRA_c [Mus musculus] |
| GI:21313658 | RefSeq | XP_006506686.1 | 163 | PREDICTED: retinoic acid receptor responder protein 2 isoform X1 [Mus musculus] |