Gene/Proteome Database (LMPD)
Proteins
diphosphoinositol polyphosphate phosphohydrolase 1 isoform 1 | |
---|---|
Refseq ID | NP_062811 |
Protein GI | 9789933 |
UniProt ID | Q9JI46 |
mRNA ID | NM_019837 |
Length | 168 |
RefSeq Status | VALIDATED |
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQCHKPVQASYFETLRQGYPANNGTPVVPTTYSSSVSGIR |
diphosphoinositol polyphosphate phosphohydrolase 1 isoform 2 | |
---|---|
Refseq ID | NP_001277975 |
Protein GI | 597517975 |
UniProt ID | B2KF67 |
mRNA ID | NM_001291046 |
Length | 139 |
RefSeq Status | VALIDATED |
MSRRVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQCHKPVQASYFETLRQGYPANNGTPVVPTTYSSSVSGIR |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleotide diphosphate linked moiety X)-type motif 3
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016787 | IEA:UniProtKB-KW | F | hydrolase activity |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleotide diphosphate linked moiety X)-type motif 3
Protein Entry
NUDT3_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Caution | The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Similarity | Belongs to the Nudix hydrolase family. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003256 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
9789933 | RefSeq | NP_062811 | 168 | diphosphoinositol polyphosphate phosphohydrolase 1 isoform 1 |
597517975 | RefSeq | NP_001277975 | 139 | diphosphoinositol polyphosphate phosphohydrolase 1 isoform 2 |
Identical Sequences to LMP003256 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:9789933 | GenBank | AAF74761.1 | 168 | diphosphoinositol polyphosphate phosphohydrolase [Mus musculus] |
GI:9789933 | GenBank | AAH16534.1 | 168 | Nudt3 protein [Mus musculus] |
GI:9789933 | GenBank | AAH46805.1 | 168 | Nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Mus musculus] |
GI:9789933 | SwissProt | Q9JI46.1 | 168 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; Short=muDIPP1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Mus musculus] |
Related Sequences to LMP003256 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:597517975 | GenBank | AAF74761.1 | 168 | diphosphoinositol polyphosphate phosphohydrolase [Mus musculus] |
GI:597517975 | GenBank | AAH16534.1 | 168 | Nudt3 protein [Mus musculus] |
GI:597517975 | GenBank | AAH46805.1 | 168 | Nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Mus musculus] |
GI:9789933 | GenBank | AAH93618.1 | 168 | Nudix (nucleoside diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
GI:597517975 | GenBank | EDL22544.1 | 135 | nudix (nucleotide diphosphate linked moiety X)-type motif 3, partial [Mus musculus] |
GI:9789933 | GenBank | EDL96893.1 | 168 | nudix (nucleotide diphosphate linked moiety X)-type motif 3 [Rattus norvegicus] |
GI:597517975 | RefSeq | NP_062811.1 | 168 | diphosphoinositol polyphosphate phosphohydrolase 1 isoform 1 [Mus musculus] |
GI:9789933 | RefSeq | NP_001019414.1 | 168 | diphosphoinositol polyphosphate phosphohydrolase 1 [Rattus norvegicus] |
GI:9789933 | RefSeq | XP_005360437.1 | 168 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Microtus ochrogaster] |
GI:9789933 | RefSeq | XP_006983195.1 | 168 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Peromyscus maniculatus bairdii] |
GI:9789933 | SwissProt | Q566C7.1 | 168 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Rattus norvegicus] |
GI:597517975 | SwissProt | Q9JI46.1 | 168 | RecName: Full=Diphosphoinositol polyphosphate phosphohydrolase 1; Short=DIPP-1; Short=muDIPP1; AltName: Full=Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1; AltName: Full=Nucleoside diphosphate-linked moiety X motif 3; Short=Nudix motif 3 [Mus musculus] |