Gene/Proteome Database (LMPD)
LMPD ID
LMP003340
Gene ID
Species
Homo sapiens (Human)
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Synonyms
CB-2; CB2; CX5
Alternate Names
cannabinoid receptor 2; testis-dominant CNR2 isoform CB2
Chromosome
1
Map Location
1p36.11
Summary
The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-protein)-coupled receptor for cannabinoids. They inhibit adenylate cyclase activity in a dose-dependent, stereoselective, and pertussis toxin-sensitive manner. These proteins have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. The cannabinoid receptors are members of family 1 of the G-protein-coupled receptors. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| cannabinoid receptor 2 | |
|---|---|
| Refseq ID | NP_001832 |
| Protein GI | 4502929 |
| UniProt ID | P34972 |
| mRNA ID | NM_001841 |
| Length | 360 |
| RefSeq Status | REVIEWED |
| MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC | |
Gene Information
Entrez Gene ID
Gene Name
cannabinoid receptor 2 (macrophage)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030425 | IEA:Ensembl | C | dendrite |
| GO:0031234 | IEA:Ensembl | C | extrinsic component of cytoplasmic side of plasma membrane |
| GO:0005887 | TAS:ProtInc | C | integral component of plasma membrane |
| GO:0043025 | IEA:Ensembl | C | neuronal cell body |
| GO:0005886 | TAS:Reactome | C | plasma membrane |
| GO:0004949 | TAS:ProtInc | F | cannabinoid receptor activity |
| GO:0007187 | TAS:ProtInc | P | G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger |
| GO:0006955 | TAS:ProtInc | P | immune response |
| GO:0006954 | IEA:UniProtKB-KW | P | inflammatory response |
| GO:0045759 | IEA:Ensembl | P | negative regulation of action potential |
| GO:0050728 | IEA:Ensembl | P | negative regulation of inflammatory response |
| GO:0033004 | IEA:Ensembl | P | negative regulation of mast cell activation |
| GO:0051001 | IEA:Ensembl | P | negative regulation of nitric-oxide synthase activity |
| GO:0032229 | IEA:Ensembl | P | negative regulation of synaptic transmission, GABAergic |
| GO:0001975 | IEA:Ensembl | P | response to amphetamine |
| GO:0032496 | IEA:Ensembl | P | response to lipopolysaccharide |
| GO:0019233 | IEA:Ensembl | P | sensory perception of pain |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_19231 | G alpha (i) signalling events |
| REACT_21340 | GPCR ligand binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
cannabinoid receptor 2 (macrophage)
Protein Entry
CNR2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. {ECO |
| Ptm | Constitutively phosphorylated on Ser-352; phosphorylation increases cell internalization and desensitizes the receptor. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
| Subcellular Location | Cell membrane; Multi-pass membrane protein. Cell projection, dendrite {ECO |
| Tissue Specificity | Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spleen, peripheral blood mononuclear cells, and thymus. PubMed:14657172 could not detect expression in normal brain. Expressed in brain by perivascular microglial cells and dorsal root ganglion sensory neurons (at protein level). Two isoforms are produced by alternative promoter usage and differ only in the 5' UTR |
Identical and Related Proteins
Unique RefSeq proteins for LMP003340 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 4502929 | RefSeq | NP_001832 | 360 | cannabinoid receptor 2 |
Identical Sequences to LMP003340 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502929 | EMBL | CAS97371.1 | 360 | unnamed protein product [Homo sapiens] |
| GI:4502929 | EMBL | CAZ76867.1 | 360 | unnamed protein product [Homo sapiens] |
| GI:4502929 | GenBank | AHD78362.1 | 360 | Sequence 26360 from patent US 8586006 |
| GI:4502929 | RefSeq | XP_005245793.1 | 360 | PREDICTED: cannabinoid receptor 2 isoform X1 [Homo sapiens] |
| GI:4502929 | RefSeq | XP_005245794.1 | 360 | PREDICTED: cannabinoid receptor 2 isoform X2 [Homo sapiens] |
| GI:4502929 | RefSeq | XP_005245795.1 | 360 | PREDICTED: cannabinoid receptor 2 isoform X3 [Homo sapiens] |
Related Sequences to LMP003340 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:4502929 | GenBank | AAH69722.1 | 360 | Cannabinoid receptor 2 (macrophage) [Homo sapiens] |
| GI:4502929 | GenBank | AAW10803.1 | 360 | Sequence 471 from patent US 6806054 |
| GI:4502929 | GenBank | ABJ30515.1 | 360 | Sequence 471 from patent US 7097969 |
| GI:4502929 | GenBank | ACE50247.1 | 360 | Sequence 471 from patent US 7381522 |
| GI:4502929 | RefSeq | XP_513201.1 | 360 | PREDICTED: cannabinoid receptor 2 [Pan troglodytes] |
| GI:4502929 | RefSeq | XP_001166334.1 | 360 | PREDICTED: cannabinoid receptor 2 [Pan troglodytes] |