Gene/Proteome Database (LMPD)

LMPD ID
LMP003356
Gene ID
14775
Species
Mus musculus (Mouse)
Gene Name
glutathione peroxidase 1
Gene Symbol
Gpx1
Synonyms
AI195024; AL033363; CGPx; GPx-1; GSHPx-1; Gpx
Alternate Names
glutathione peroxidase 1; cellular glutathione peroxidase; selenium-dependent glutathione peroxidase 1
Chromosome
9
Map Location
9 F1|9 59.24 cM
EC Number
1.11.1.9
Summary
This gene product belongs to the family of glutathione peroxidase, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for Gpx1

Proteins

glutathione peroxidase 1
Refseq ID NP_032186
Protein GI 84871986
UniProt ID P11352
mRNA ID NM_008160
Length 201
RefSeq Status REVIEWED
MCAARLSAAAQSTVYAFSARPLTGGEPVSLGSLRGKVLLIENVASLUGTTIRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPTPSDDPTALMTDPKYIIWSPVCRNDIAWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIETLLSQQSGNS

Gene Information

Entrez Gene ID
14775
Gene Name
glutathione peroxidase 1
Gene Symbol
Gpx1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 ISS:BHF-UCL C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005739 IDA:MGI C mitochondrion
GO:0005634 IEA:Ensembl C nucleus
GO:0043295 IEA:Ensembl F glutathione binding
GO:0004602 IDA:MGI F glutathione peroxidase activity
GO:0047066 IEA:Ensembl F phospholipid-hydroperoxide glutathione peroxidase activity
GO:0008430 IEA:Ensembl F selenium binding
GO:0009650 IEA:Ensembl P UV protection
GO:0007568 IEA:Ensembl P aging
GO:0060055 IMP:MGI P angiogenesis involved in wound healing
GO:0006915 IMP:MGI P apoptotic process
GO:0043534 IMP:MGI P blood vessel endothelial cell migration
GO:0008283 IMP:MGI P cell proliferation
GO:0045454 IEA:Ensembl P cell redox homeostasis
GO:0001885 IMP:MGI P endothelial cell development
GO:0045444 IMP:MGI P fat cell differentiation
GO:0006749 IEA:Ensembl P glutathione metabolic process
GO:0060047 IMP:MGI P heart contraction
GO:0042744 IMP:MGI P hydrogen peroxide catabolic process
GO:0051702 IGI:MGI P interaction with symbiont
GO:0008631 IMP:MGI P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0006629 IMP:MGI P lipid metabolic process
GO:0051450 IMP:MGI P myoblast proliferation
GO:0014902 IMP:MGI P myotube differentiation
GO:0043066 IMP:MGI P negative regulation of apoptotic process
GO:0043154 IEA:Ensembl P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902042 IEA:Ensembl P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0002862 IGI:MGI P negative regulation of inflammatory response to antigenic stimulus
GO:1902176 IMP:MGI P negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:0090201 IEA:Ensembl P negative regulation of release of cytochrome c from mitochondria
GO:0051897 IMP:MGI P positive regulation of protein kinase B signaling
GO:0018158 IMP:MGI P protein oxidation
GO:0040029 IEA:Ensembl P regulation of gene expression, epigenetic
GO:0033599 IEA:Ensembl P regulation of mammary gland epithelial cell proliferation
GO:0043523 IMP:MGI P regulation of neuron apoptotic process
GO:0061136 IEA:Ensembl P regulation of proteasomal protein catabolic process
GO:0032355 IEA:Ensembl P response to estradiol
GO:0051593 IEA:Ensembl P response to folic acid
GO:0010332 IGI:MGI P response to gamma radiation
GO:0009749 IEA:Ensembl P response to glucose
GO:0042542 ISS:BHF-UCL P response to hydrogen peroxide
GO:0033194 IMP:MGI P response to hydroperoxide
GO:0006982 IEA:Ensembl P response to lipid hydroperoxide
GO:0035094 IEA:Ensembl P response to nicotine
GO:0006979 IMP:MGI P response to oxidative stress
GO:0000302 IMP:MGI P response to reactive oxygen species
GO:0010269 IEA:Ensembl P response to selenium ion
GO:0009609 IGI:MGI P response to symbiotic bacterium
GO:0009636 IMP:MGI P response to toxic substance
GO:0009611 IMP:MGI P response to wounding
GO:0009410 IMP:MGI P response to xenobiotic stimulus
GO:0007605 IMP:MGI P sensory perception of sound
GO:0048741 IMP:MGI P skeletal muscle fiber development
GO:0043403 IMP:MGI P skeletal muscle tissue regeneration
GO:0001659 IGI:MGI P temperature homeostasis
GO:0006641 IMP:MGI P triglyceride metabolic process
GO:0042311 IMP:MGI P vasodilation

KEGG Pathway Links

KEGG Pathway ID Description
mmu04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 1
Protein Entry
GPX1_MOUSE
UniProt ID
P11352
Species
Mouse

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=14 uM for H(2)O(2) (at 25 degrees Celsius, in 0.1 M phosphate buffer, pH 7.0) {ECO:0000269|PubMed:21420488}; KM=29 uM for tert-butylperoxide (at 25 degrees Celsius, in 0.1 M phosphate buffer, pH 7.0) {ECO:0000269|PubMed:21420488}; Vmax=319 mM/min/mg enzyme toward H(2)O(2) (at 25 degrees Celsius, in 0.1 M phosphate buffer, pH 7.0) {ECO:0000269|PubMed:21420488}; Vmax=182 mM/min/mg enzyme toward tert-butylperoxide (at 25 degrees Celsius, in 0.1 M phosphate buffer, pH 7.0) {ECO:0000269|PubMed:21420488};
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Caution PubMed:2771650 sequence was originally thought to originate from human. {ECO:0000305}.
Function Protects the hemoglobin in erythrocytes from oxidative breakdown.
Miscellaneous In the absence of Sod1, Gpx1 in the liver undergoes a 40% reduction in catalytic activity as a result of the decomposition of Sec-47 to dehydroalanine. {ECO:0000305|PubMed:21420488}.
Ptm During periods of oxidative stress, Sec-47 may react with a superoxide radical, irreversibly lose hydroselenide and be converted to dehydroalanine. {ECO:0000269|PubMed:21420488}.
Sequence Caution Sequence=CAB43535.1; Type=Miscellaneous discrepancy; Note=Number of sequencing artifacts.; Evidence={ECO:0000305};
Similarity Belongs to the glutathione peroxidase family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Homotetramer. Interacts with MIEN1. {ECO:0000269|PubMed:17503775}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003356 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
84871986 RefSeq NP_032186 201 glutathione peroxidase 1

Identical Sequences to LMP003356 proteins

Reference Database Accession Length Protein Name
GI:84871986 DBBJ BAC55253.1 201 unnamed protein product [Mus musculus]
GI:84871986 DBBJ BAC55257.1 201 unnamed protein product [Mus musculus]
GI:84871986 DBBJ BAE35760.1 201 unnamed protein product [Mus musculus]
GI:84871986 DBBJ BAE29650.1 201 unnamed protein product [Mus musculus]
GI:84871986 DBBJ BAE32862.1 201 unnamed protein product [Mus musculus]
GI:84871986 SwissProt P11352.2 201 RecName: Full=Glutathione peroxidase 1; Short=GPx-1; Short=GSHPx-1; AltName: Full=Cellular glutathione peroxidase; AltName: Full=Selenium-dependent glutathione peroxidase 1 [Mus musculus]

Related Sequences to LMP003356 proteins

Reference Database Accession Length Protein Name
GI:84871986 EMBL CAA27558.1 201 glutathione peroxidase [Mus musculus]
GI:84871986 GenBank AAK72702.1 201 selenium-dependent glutathione peroxidase [Rattus norvegicus]
GI:84871986 GenBank AAH86649.1 201 Glutathione peroxidase 1 [Mus musculus]
GI:84871986 GenBank AFT61581.1 201 Sequence 60 from patent US 8273549
GI:84871986 RefSeq NP_110453.3 201 glutathione peroxidase 1 [Rattus norvegicus]
GI:84871986 RefSeq NP_001243717.1 201 glutathione peroxidase 1 [Cricetulus griseus]