Gene/Proteome Database (LMPD)
LMPD ID
LMP003385
Gene ID
Species
Homo sapiens (Human)
Gene Name
caveolin 1, caveolae protein, 22kDa
Gene Symbol
Synonyms
BSCL3; CGL3; LCCNS; MSTP085; PPH3; VIP21
Alternate Names
caveolin-1; cell growth-inhibiting protein 32
Chromosome
7
Map Location
7q31.1
Summary
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010]
Orthologs
Proteins
caveolin-1 isoform alpha | |
---|---|
Refseq ID | NP_001744 |
Protein GI | 15451856 |
UniProt ID | Q59E85 |
mRNA ID | NM_001753 |
Length | 178 |
RefSeq Status | REVIEWED |
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI |
caveolin-1 isoform beta | |
---|---|
Refseq ID | NP_001166366 |
Protein GI | 290542359 |
UniProt ID | Q59E85 |
mRNA ID | NM_001172895 |
Length | 147 |
RefSeq Status | REVIEWED |
MADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI |
caveolin-1 isoform beta | |
---|---|
Refseq ID | NP_001166368 |
Protein GI | 290542363 |
UniProt ID | Q59E85 |
mRNA ID | NM_001172897 |
Length | 147 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:290542359 (mRNA isoform) |
caveolin-1 isoform beta | |
---|---|
Refseq ID | NP_001166367 |
Protein GI | 290542361 |
UniProt ID | Q7Z4F3 |
mRNA ID | NM_001172896 |
Length | 147 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:290542359 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
caveolin 1, caveolae protein, 22kDa
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0002080 | IEA:Ensembl | C | acrosomal membrane |
GO:0016324 | IDA:BHF-UCL | C | apical plasma membrane |
GO:0016323 | IDA:BHF-UCL | C | basolateral plasma membrane |
GO:0005901 | IDA:UniProtKB | C | caveola |
GO:0005938 | IEA:Ensembl | C | cell cortex |
GO:0005929 | IEA:Ensembl | C | cilium |
GO:0031410 | IDA:UniProtKB | C | cytoplasmic vesicle |
GO:0030666 | TAS:Reactome | C | endocytic vesicle membrane |
GO:0005783 | IDA:HGNC | C | endoplasmic reticulum |
GO:0005768 | IDA:UniProtKB | C | endosome |
GO:0005925 | IDA:UniProtKB | C | focal adhesion |
GO:0000139 | IDA:HGNC | C | Golgi membrane |
GO:0005887 | IEA:Ensembl | C | integral component of plasma membrane |
GO:0005622 | IDA:BHF-UCL | C | intracellular |
GO:0005811 | TAS:Reactome | C | lipid particle |
GO:0045121 | IDA:UniProtKB | C | membrane raft |
GO:0048471 | IDA:UniProtKB | C | perinuclear region of cytoplasm |
GO:0005886 | IDA:UniProtKB | C | plasma membrane |
GO:0043234 | IDA:MGI | C | protein complex |
GO:0015485 | TAS:HGNC | F | cholesterol binding |
GO:0019899 | IPI:UniProtKB | F | enzyme binding |
GO:0050998 | IPI:BHF-UCL | F | nitric-oxide synthase binding |
GO:0005113 | NAS:BHF-UCL | F | patched binding |
GO:0016504 | ISS:BHF-UCL | F | peptidase activator activity |
GO:0032947 | TAS:BHF-UCL | F | protein complex scaffold |
GO:0005102 | IPI:BHF-UCL | F | receptor binding |
GO:0005198 | IDA:UniProtKB | F | structural molecule activity |
GO:0001525 | IEA:Ensembl | P | angiogenesis |
GO:0097190 | IMP:UniProtKB | P | apoptotic signaling pathway |
GO:0007596 | TAS:Reactome | P | blood coagulation |
GO:0055074 | ISS:BHF-UCL | P | calcium ion homeostasis |
GO:0006816 | ISS:BHF-UCL | P | calcium ion transport |
GO:0070836 | IMP:BHF-UCL | P | caveola assembly |
GO:0072584 | IDA:UniProtKB | P | caveolin-mediated endocytosis |
GO:0006874 | ISS:BHF-UCL | P | cellular calcium ion homeostasis |
GO:0071455 | IMP:UniProtKB | P | cellular response to hyperoxia |
GO:0009267 | IEP:BHF-UCL | P | cellular response to starvation |
GO:0042632 | ISS:BHF-UCL | P | cholesterol homeostasis |
GO:0030301 | TAS:HGNC | P | cholesterol transport |
GO:0051480 | IDA:BHF-UCL | P | cytosolic calcium ion homeostasis |
GO:0000188 | ISS:BHF-UCL | P | inactivation of MAPK activity |
GO:0007595 | IEA:Ensembl | P | lactation |
GO:0050900 | TAS:Reactome | P | leukocyte migration |
GO:0019915 | ISS:BHF-UCL | P | lipid storage |
GO:0032507 | ISS:BHF-UCL | P | maintenance of protein location in cell |
GO:0030879 | ISS:BHF-UCL | P | mammary gland development |
GO:0060056 | ISS:BHF-UCL | P | mammary gland involution |
GO:0000165 | IEA:Ensembl | P | MAPK cascade |
GO:0051899 | ISS:BHF-UCL | P | membrane depolarization |
GO:2000811 | IMP:UniProtKB | P | negative regulation of anoikis |
GO:0030514 | IDA:BHF-UCL | P | negative regulation of BMP signaling pathway |
GO:0090090 | ISS:UniProtKB | P | negative regulation of canonical Wnt signaling pathway |
GO:0001960 | IEA:Ensembl | P | negative regulation of cytokine-mediated signaling pathway |
GO:0001937 | ISS:BHF-UCL | P | negative regulation of endothelial cell proliferation |
GO:0030857 | ISS:BHF-UCL | P | negative regulation of epithelial cell differentiation |
GO:0046426 | ISS:BHF-UCL | P | negative regulation of JAK-STAT cascade |
GO:0043409 | ISS:BHF-UCL | P | negative regulation of MAPK cascade |
GO:0045019 | ISS:BHF-UCL | P | negative regulation of nitric oxide biosynthetic process |
GO:0051001 | IEA:Ensembl | P | negative regulation of nitric-oxide synthase activity |
GO:0033137 | IDA:BHF-UCL | P | negative regulation of peptidyl-serine phosphorylation |
GO:0048550 | IMP:UniProt | P | negative regulation of pinocytosis |
GO:0032091 | IDA:BHF-UCL | P | negative regulation of protein binding |
GO:0031397 | IMP:UniProtKB | P | negative regulation of protein ubiquitination |
GO:0000122 | ISS:UniProtKB | P | negative regulation of transcription from RNA polymerase II promoter |
GO:0042524 | IEA:Ensembl | P | negative regulation of tyrosine phosphorylation of Stat5 protein |
GO:0033484 | ISS:BHF-UCL | P | nitric oxide homeostasis |
GO:0046209 | TAS:Reactome | P | nitric oxide metabolic process |
GO:0010524 | ISS:BHF-UCL | P | positive regulation of calcium ion transport into cytosol |
GO:0090263 | IMP:BHF-UCL | P | positive regulation of canonical Wnt signaling pathway |
GO:2001238 | IMP:UniProtKB | P | positive regulation of extrinsic apoptotic signaling pathway |
GO:2001244 | IMP:UniProtKB | P | positive regulation of intrinsic apoptotic signaling pathway |
GO:0048554 | ISS:BHF-UCL | P | positive regulation of metalloenzyme activity |
GO:0033138 | IDA:BHF-UCL | P | positive regulation of peptidyl-serine phosphorylation |
GO:0045907 | ISS:BHF-UCL | P | positive regulation of vasoconstriction |
GO:0051260 | ISS:BHF-UCL | P | protein homooligomerization |
GO:0008104 | ISS:BHF-UCL | P | protein localization |
GO:2000286 | IMP:BHF-UCL | P | receptor internalization involved in canonical Wnt signaling pathway |
GO:0030193 | IMP:BHF-UCL | P | regulation of blood coagulation |
GO:0019217 | ISS:BHF-UCL | P | regulation of fatty acid metabolic process |
GO:0050999 | TAS:Reactome | P | regulation of nitric-oxide synthase activity |
GO:0052547 | ISS:BHF-UCL | P | regulation of peptidase activity |
GO:0006940 | ISS:BHF-UCL | P | regulation of smooth muscle contraction |
GO:0003057 | IEA:Ensembl | P | regulation of the force of heart contraction by chemical signal |
GO:0051592 | ISS:BHF-UCL | P | response to calcium ion |
GO:0043627 | IDA:MGI | P | response to estrogen |
GO:0001666 | ISS:BHF-UCL | P | response to hypoxia |
GO:0002931 | IEA:Ensembl | P | response to ischemia |
GO:0032570 | IDA:MGI | P | response to progesterone |
GO:0007519 | ISS:BHF-UCL | P | skeletal muscle tissue development |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0031295 | IDA:UniProtKB | P | T cell costimulation |
GO:0006641 | ISS:BHF-UCL | P | triglyceride metabolic process |
GO:0001570 | ISS:BHF-UCL | P | vasculogenesis |
GO:0042310 | IEA:Ensembl | P | vasoconstriction |
GO:0016050 | IDA:BHF-UCL | P | vesicle organization |
GO:0016032 | IEA:UniProtKB-KW | P | viral process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa05205 | Proteoglycans in cancer |
Domain Information
UniProt Annotations
Entry Information
Gene Name
caveolin 1, caveolae protein, 22kDa
Protein Entry
Q2TNI1_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=1; IsoId=Q03135-1; Sequence=Displayed; Name=2; IsoId=Q03135-2; Sequence=VSP_018692; Note=Initiator Met-1 is removed. Contains a N-acetylalanine at position 2. Contains a phosphoserine at position 6.; |
Disease | Congenital generalized lipodystrophy 3 (CGL3) [MIM |
Disease | Partial lipodystrophy, congenital cataracts, and neurodegeneration syndrome (LCCNS) [MIM |
Disease | Pulmonary hypertension, primary, 3 (PPH3) [MIM |
Function | May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3- dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. {ECO |
Interaction | O70239:Axin1 (xeno); NbExp=5; IntAct=EBI-603614, EBI-6857773; P55957:BID; NbExp=3; IntAct=EBI-603614, EBI-519672; P00533:EGFR; NbExp=5; IntAct=EBI-603614, EBI-297353; P25116:F2R; NbExp=3; IntAct=EBI-603614, EBI-2803960; P25445:FAS; NbExp=3; IntAct=EBI-603614, EBI-494743; Q03160:Grb7 (xeno); NbExp=3; IntAct=EBI-603614, EBI-7100053; P41134:ID1; NbExp=6; IntAct=EBI-603614, EBI-1215527; O75581:LRP6; NbExp=3; IntAct=EBI-603614, EBI-910915; Q07820:MCL1; NbExp=3; IntAct=EBI-603614, EBI-1003422; P04150:NR3C1; NbExp=2; IntAct=EBI-603614, EBI-493507; P18031:PTPN1; NbExp=5; IntAct=EBI-603614, EBI-968788; P22307:SCP2; NbExp=3; IntAct=EBI-603614, EBI-1050999; Q16881:TXNRD1; NbExp=4; IntAct=EBI-603614, EBI-716617; |
Ptm | Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress. {ECO |
Ptm | The initiator methionine for isoform 2 is removed during or just after translation. The new N-terminal amino acid is then N- acetylated. {ECO |
Similarity | Belongs to the caveolin family. |
Subcellular Location | Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Membrane raft. Note=Colocalized with DPP4 in membrane rafts. Potential hairpin- like structure in the membrane. Membrane protein of caveolae. |
Subunit | Homooligomer. Interacts with GLIPR2, NOSTRIN, SNAP25 and STX1A. Interacts with rotavirus A NSP4. Interacts (via the N- terminus) with DPP4; the interaction is direct. Interacts with CTNNB1, CDH1 and JUP. Interacts with PACSIN2. Interacts with SLC7A9 (By similarity). Interacts with BMX and BTK. {ECO |
Tissue Specificity | Expressed in muscle and lung, less so in liver, brain and kidney. |
Web Resource | Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/CAV1ID932ch7q31.html"; |
Web Resource | Name=Wikipedia; Note=Caveolin entry; URL="http://en.wikipedia.org/wiki/Caveolin"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP003385 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15451856 | RefSeq | NP_001744 | 178 | caveolin-1 isoform alpha |
290542359 | RefSeq | NP_001166366 | 147 | caveolin-1 isoform beta |
Identical Sequences to LMP003385 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15451856 | GenBank | AHD69762.1 | 178 | Sequence 1351 from patent US 8586006 |
GI:15451856 | GenBank | AHE20767.1 | 178 | Sequence 40 from patent US 8575304 |
GI:15451856 | GenBank | AIC48423.1 | 178 | CAV1, partial [synthetic construct] |
GI:15451856 | RefSeq | NP_001271690.1 | 178 | uncharacterized protein LOC101865646 [Macaca fascicularis] |
GI:15451856 | RefSeq | XP_007980867.1 | 178 | PREDICTED: caveolin-1 isoform X2 [Chlorocebus sabaeus] |
GI:290542359 | RefSeq | XP_007980868.1 | 147 | PREDICTED: caveolin-1 isoform X3 [Chlorocebus sabaeus] |
GI:290542359 | RefSeq | XP_008958972.1 | 147 | PREDICTED: caveolin-1 isoform X2 [Pan paniscus] |
GI:290542359 | RefSeq | XP_008958973.1 | 147 | PREDICTED: caveolin-1 isoform X2 [Pan paniscus] |
GI:290542359 | RefSeq | XP_009452297.1 | 147 | PREDICTED: caveolin-1 isoform X1 [Pan troglodytes] |
GI:290542359 | RefSeq | XP_009452299.1 | 147 | PREDICTED: caveolin-1 isoform X1 [Pan troglodytes] |
GI:15451856 | RefSeq | XP_010387648.1 | 178 | PREDICTED: caveolin-1 isoform X2 [Rhinopithecus roxellana] |
GI:290542359 | RefSeq | XP_010387649.1 | 147 | PREDICTED: caveolin-1 isoform X3 [Rhinopithecus roxellana] |
Related Sequences to LMP003385 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:290542359 | GenBank | AAP35807.1 | 178 | caveolin 1, caveolae protein, 22kDa [Homo sapiens] |
GI:15451856 | GenBank | AAP36880.1 | 179 | Homo sapiens caveolin 1, caveolae protein, 22kDa, partial [synthetic construct] |
GI:15451856 | GenBank | AAX43589.1 | 179 | caveolin 1, partial [synthetic construct] |
GI:290542359 | GenBank | ABM81573.1 | 178 | caveolin 1, caveolae protein, 22kDa [synthetic construct] |
GI:290542359 | GenBank | ABM84753.1 | 178 | caveolin 1, caveolae protein, 22kDa, partial [synthetic construct] |
GI:15451856 | GenBank | ACM84962.1 | 195 | Sequence 10460 from patent US 6812339 |
GI:290542359 | GenBank | ACP87498.1 | 178 | Sequence 140 from patent US 7504211 |
GI:290542359 | GenBank | AHD69762.1 | 178 | Sequence 1351 from patent US 8586006 |
GI:15451856 | gnl | NISC-CON | 178 | caveolin 1 [Papio anubis] |
GI:15451856 | RefSeq | NP_001162182.1 | 178 | caveolin-1 [Papio anubis] |
GI:290542359 | RefSeq | XP_003808702.1 | 178 | PREDICTED: caveolin-1 isoform X1 [Pan paniscus] |
GI:15451856 | SwissProt | A0M8R6.1 | 178 | RecName: Full=Caveolin-1 [Papio anubis] |