Gene/Proteome Database (LMPD)

LMPD ID
LMP003385
Gene ID
857
Species
Homo sapiens (Human)
Gene Name
caveolin 1, caveolae protein, 22kDa
Gene Symbol
CAV1
Synonyms
BSCL3; CGL3; LCCNS; MSTP085; PPH3; VIP21
Alternate Names
caveolin-1; cell growth-inhibiting protein 32
Chromosome
7
Map Location
7q31.1
Summary
The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 mitogen-activated kinase cascade. Caveolin 1 and caveolin 2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. Mutations in this gene have been associated with Berardinelli-Seip congenital lipodystrophy. Alternatively spliced transcripts encode alpha and beta isoforms of caveolin 1.[provided by RefSeq, Mar 2010]
Orthologs
View orthologs and multiple alignments for CAV1

Proteins

caveolin-1 isoform alpha
Refseq ID NP_001744
Protein GI 15451856
UniProt ID Q59E85
mRNA ID NM_001753
Length 178
RefSeq Status REVIEWED
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
caveolin-1 isoform beta
Refseq ID NP_001166366
Protein GI 290542359
UniProt ID Q59E85
mRNA ID NM_001172895
Length 147
RefSeq Status REVIEWED
MADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI
caveolin-1 isoform beta
Refseq ID NP_001166368
Protein GI 290542363
UniProt ID Q59E85
mRNA ID NM_001172897
Length 147
RefSeq Status REVIEWED
Protein sequence is identical to GI:290542359 (mRNA isoform)
caveolin-1 isoform beta
Refseq ID NP_001166367
Protein GI 290542361
UniProt ID Q7Z4F3
mRNA ID NM_001172896
Length 147
RefSeq Status REVIEWED
Protein sequence is identical to GI:290542359 (mRNA isoform)

Gene Information

Entrez Gene ID
857
Gene Name
caveolin 1, caveolae protein, 22kDa
Gene Symbol
CAV1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 IDA:HGNC C Golgi membrane
GO:0002080 IEA:Ensembl C acrosomal membrane
GO:0016324 IDA:BHF-UCL C apical plasma membrane
GO:0016323 IDA:BHF-UCL C basolateral plasma membrane
GO:0005901 IDA:UniProtKB C caveola
GO:0005938 IEA:Ensembl C cell cortex
GO:0005929 IEA:Ensembl C cilium
GO:0031410 IDA:UniProtKB C cytoplasmic vesicle
GO:0030666 TAS:Reactome C endocytic vesicle membrane
GO:0005783 IDA:HGNC C endoplasmic reticulum
GO:0005768 IDA:UniProtKB C endosome
GO:0005925 IDA:UniProtKB C focal adhesion
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0005622 IDA:BHF-UCL C intracellular
GO:0005811 TAS:Reactome C lipid particle
GO:0045121 IDA:UniProtKB C membrane raft
GO:0048471 IDA:UniProtKB C perinuclear region of cytoplasm
GO:0005886 IDA:UniProtKB C plasma membrane
GO:0043234 IDA:MGI C protein complex
GO:0015485 TAS:HGNC F cholesterol binding
GO:0019899 IPI:UniProtKB F enzyme binding
GO:0050998 IPI:BHF-UCL F nitric-oxide synthase binding
GO:0005113 NAS:BHF-UCL F patched binding
GO:0016504 ISS:BHF-UCL F peptidase activator activity
GO:0032947 TAS:BHF-UCL F protein complex scaffold
GO:0005102 IPI:BHF-UCL F receptor binding
GO:0005198 IDA:UniProtKB F structural molecule activity
GO:0000165 IEA:Ensembl P MAPK cascade
GO:0031295 IDA:UniProtKB P T cell costimulation
GO:0001525 IEA:Ensembl P angiogenesis
GO:0097190 IMP:UniProtKB P apoptotic signaling pathway
GO:0007596 TAS:Reactome P blood coagulation
GO:0055074 ISS:BHF-UCL P calcium ion homeostasis
GO:0006816 ISS:BHF-UCL P calcium ion transport
GO:0070836 IMP:BHF-UCL P caveola assembly
GO:0072584 IDA:UniProtKB P caveolin-mediated endocytosis
GO:0006874 ISS:BHF-UCL P cellular calcium ion homeostasis
GO:0071455 IMP:UniProtKB P cellular response to hyperoxia
GO:0009267 IEP:BHF-UCL P cellular response to starvation
GO:0042632 ISS:BHF-UCL P cholesterol homeostasis
GO:0030301 TAS:HGNC P cholesterol transport
GO:0051480 IDA:BHF-UCL P cytosolic calcium ion homeostasis
GO:0000188 ISS:BHF-UCL P inactivation of MAPK activity
GO:0007595 IEA:Ensembl P lactation
GO:0050900 TAS:Reactome P leukocyte migration
GO:0019915 ISS:BHF-UCL P lipid storage
GO:0032507 ISS:BHF-UCL P maintenance of protein location in cell
GO:0030879 ISS:BHF-UCL P mammary gland development
GO:0060056 ISS:BHF-UCL P mammary gland involution
GO:0051899 ISS:BHF-UCL P membrane depolarization
GO:0030514 IDA:BHF-UCL P negative regulation of BMP signaling pathway
GO:0046426 ISS:BHF-UCL P negative regulation of JAK-STAT cascade
GO:0043409 ISS:BHF-UCL P negative regulation of MAPK cascade
GO:2000811 IMP:UniProtKB P negative regulation of anoikis
GO:0090090 ISS:UniProtKB P negative regulation of canonical Wnt signaling pathway
GO:0001960 IEA:Ensembl P negative regulation of cytokine-mediated signaling pathway
GO:0001937 ISS:BHF-UCL P negative regulation of endothelial cell proliferation
GO:0030857 ISS:BHF-UCL P negative regulation of epithelial cell differentiation
GO:0045019 ISS:BHF-UCL P negative regulation of nitric oxide biosynthetic process
GO:0051001 IEA:Ensembl P negative regulation of nitric-oxide synthase activity
GO:0033137 IDA:BHF-UCL P negative regulation of peptidyl-serine phosphorylation
GO:0048550 IMP:UniProt P negative regulation of pinocytosis
GO:0032091 IDA:BHF-UCL P negative regulation of protein binding
GO:0031397 IMP:UniProtKB P negative regulation of protein ubiquitination
GO:0000122 ISS:UniProtKB P negative regulation of transcription from RNA polymerase II promoter
GO:0042524 IEA:Ensembl P negative regulation of tyrosine phosphorylation of Stat5 protein
GO:0033484 ISS:BHF-UCL P nitric oxide homeostasis
GO:0046209 TAS:Reactome P nitric oxide metabolic process
GO:0010524 ISS:BHF-UCL P positive regulation of calcium ion transport into cytosol
GO:0090263 IMP:BHF-UCL P positive regulation of canonical Wnt signaling pathway
GO:2001238 IMP:UniProtKB P positive regulation of extrinsic apoptotic signaling pathway
GO:2001244 IMP:UniProtKB P positive regulation of intrinsic apoptotic signaling pathway
GO:0048554 ISS:BHF-UCL P positive regulation of metalloenzyme activity
GO:0033138 IDA:BHF-UCL P positive regulation of peptidyl-serine phosphorylation
GO:0045907 ISS:BHF-UCL P positive regulation of vasoconstriction
GO:0051260 ISS:BHF-UCL P protein homooligomerization
GO:0008104 ISS:BHF-UCL P protein localization
GO:2000286 IMP:BHF-UCL P receptor internalization involved in canonical Wnt signaling pathway
GO:0030193 IMP:BHF-UCL P regulation of blood coagulation
GO:0019217 ISS:BHF-UCL P regulation of fatty acid metabolic process
GO:0050999 TAS:Reactome P regulation of nitric-oxide synthase activity
GO:0052547 ISS:BHF-UCL P regulation of peptidase activity
GO:0006940 ISS:BHF-UCL P regulation of smooth muscle contraction
GO:0003057 IEA:Ensembl P regulation of the force of heart contraction by chemical signal
GO:0051592 ISS:BHF-UCL P response to calcium ion
GO:0043627 IDA:MGI P response to estrogen
GO:0001666 ISS:BHF-UCL P response to hypoxia
GO:0002931 IEA:Ensembl P response to ischemia
GO:0032570 IDA:MGI P response to progesterone
GO:0007519 ISS:BHF-UCL P skeletal muscle tissue development
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0006641 ISS:BHF-UCL P triglyceride metabolic process
GO:0001570 ISS:BHF-UCL P vasculogenesis
GO:0042310 IEA:Ensembl P vasoconstriction
GO:0016050 IDA:BHF-UCL P vesicle organization
GO:0016032 IEA:UniProtKB-KW P viral process

KEGG Pathway Links

KEGG Pathway ID Description
hsa05205 Proteoglycans in cancer

Domain Information

InterPro Annotations

Accession Description
IPR001612 Caveolin
IPR018361 Caveolin, conserved site
IPR015504 Caveolin_1

UniProt Annotations

Entry Information

Gene Name
caveolin 1, caveolae protein, 22kDa
Protein Entry
Q2TNI1_HUMAN
UniProt ID
Q7Z4F3
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative initiation; Named isoforms=2; Name=1; IsoId=Q03135-1; Sequence=Displayed; Name=2; IsoId=Q03135-2; Sequence=VSP_018692; Note=Initiator Met-1 is removed. Contains a N-acetylalanine at position 2. Contains a phosphoserine at position 6.;
Disease Congenital generalized lipodystrophy 3 (CGL3) [MIM
Disease Partial lipodystrophy, congenital cataracts, and neurodegeneration syndrome (LCCNS) [MIM
Disease Pulmonary hypertension, primary, 3 (PPH3) [MIM
Function May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity (By similarity). Involved in the costimulatory signal essential for T-cell receptor (TCR)- mediated T-cell activation. Its binding to DPP4 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3- dependent manner. Recruits CTNNB1 to caveolar membranes and may regulate CTNNB1-mediated signaling through the Wnt pathway. {ECO
Interaction O70239:Axin1 (xeno); NbExp=5; IntAct=EBI-603614, EBI-6857773; P55957:BID; NbExp=3; IntAct=EBI-603614, EBI-519672; P00533:EGFR; NbExp=5; IntAct=EBI-603614, EBI-297353; P25116:F2R; NbExp=3; IntAct=EBI-603614, EBI-2803960; P25445:FAS; NbExp=3; IntAct=EBI-603614, EBI-494743; Q03160:Grb7 (xeno); NbExp=3; IntAct=EBI-603614, EBI-7100053; P41134:ID1; NbExp=6; IntAct=EBI-603614, EBI-1215527; O75581:LRP6; NbExp=3; IntAct=EBI-603614, EBI-910915; Q07820:MCL1; NbExp=3; IntAct=EBI-603614, EBI-1003422; P04150:NR3C1; NbExp=2; IntAct=EBI-603614, EBI-493507; P18031:PTPN1; NbExp=5; IntAct=EBI-603614, EBI-968788; P22307:SCP2; NbExp=3; IntAct=EBI-603614, EBI-1050999; Q16881:TXNRD1; NbExp=4; IntAct=EBI-603614, EBI-716617;
Ptm Phosphorylated at Tyr-14 by ABL1 in response to oxidative stress. {ECO
Ptm The initiator methionine for isoform 2 is removed during or just after translation. The new N-terminal amino acid is then N- acetylated. {ECO
Similarity Belongs to the caveolin family.
Subcellular Location Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Membrane raft. Note=Colocalized with DPP4 in membrane rafts. Potential hairpin- like structure in the membrane. Membrane protein of caveolae.
Subunit Homooligomer. Interacts with GLIPR2, NOSTRIN, SNAP25 and STX1A. Interacts with rotavirus A NSP4. Interacts (via the N- terminus) with DPP4; the interaction is direct. Interacts with CTNNB1, CDH1 and JUP. Interacts with PACSIN2. Interacts with SLC7A9 (By similarity). Interacts with BMX and BTK. {ECO
Tissue Specificity Expressed in muscle and lung, less so in liver, brain and kidney.
Web Resource Name=Atlas of Genetics and Cytogenetics in Oncology and Haematology; URL="http://atlasgeneticsoncology.org/Genes/CAV1ID932ch7q31.html";
Web Resource Name=Wikipedia; Note=Caveolin entry; URL="http://en.wikipedia.org/wiki/Caveolin";

Identical and Related Proteins

Unique RefSeq proteins for LMP003385 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15451856 RefSeq NP_001744 178 caveolin-1 isoform alpha
290542359 RefSeq NP_001166366 147 caveolin-1 isoform beta

Identical Sequences to LMP003385 proteins

Reference Database Accession Length Protein Name
GI:15451856 GenBank AHD69762.1 178 Sequence 1351 from patent US 8586006
GI:15451856 GenBank AHE20767.1 178 Sequence 40 from patent US 8575304
GI:15451856 GenBank AIC48423.1 178 CAV1, partial [synthetic construct]
GI:15451856 RefSeq NP_001271690.1 178 uncharacterized protein LOC101865646 [Macaca fascicularis]
GI:15451856 RefSeq XP_007980867.1 178 PREDICTED: caveolin-1 isoform X2 [Chlorocebus sabaeus]
GI:290542359 RefSeq XP_007980868.1 147 PREDICTED: caveolin-1 isoform X3 [Chlorocebus sabaeus]
GI:290542359 RefSeq XP_008958972.1 147 PREDICTED: caveolin-1 isoform X2 [Pan paniscus]
GI:290542359 RefSeq XP_008958973.1 147 PREDICTED: caveolin-1 isoform X2 [Pan paniscus]
GI:290542359 RefSeq XP_009452297.1 147 PREDICTED: caveolin-1 isoform X1 [Pan troglodytes]
GI:290542359 RefSeq XP_009452299.1 147 PREDICTED: caveolin-1 isoform X1 [Pan troglodytes]
GI:15451856 RefSeq XP_010387648.1 178 PREDICTED: caveolin-1 isoform X2 [Rhinopithecus roxellana]
GI:290542359 RefSeq XP_010387649.1 147 PREDICTED: caveolin-1 isoform X3 [Rhinopithecus roxellana]

Related Sequences to LMP003385 proteins

Reference Database Accession Length Protein Name
GI:290542359 GenBank AAP35807.1 178 caveolin 1, caveolae protein, 22kDa [Homo sapiens]
GI:15451856 GenBank AAP36880.1 179 Homo sapiens caveolin 1, caveolae protein, 22kDa, partial [synthetic construct]
GI:15451856 GenBank AAX43589.1 179 caveolin 1, partial [synthetic construct]
GI:290542359 GenBank ABM81573.1 178 caveolin 1, caveolae protein, 22kDa [synthetic construct]
GI:290542359 GenBank ABM84753.1 178 caveolin 1, caveolae protein, 22kDa, partial [synthetic construct]
GI:15451856 GenBank ACM84962.1 195 Sequence 10460 from patent US 6812339
GI:290542359 GenBank ACP87498.1 178 Sequence 140 from patent US 7504211
GI:290542359 GenBank AHD69762.1 178 Sequence 1351 from patent US 8586006
GI:15451856 gnl NISC-CON 178 caveolin 1 [Papio anubis]
GI:15451856 RefSeq NP_001162182.1 178 caveolin-1 [Papio anubis]
GI:290542359 RefSeq XP_003808702.1 178 PREDICTED: caveolin-1 isoform X1 [Pan paniscus]
GI:15451856 SwissProt A0M8R6.1 178 RecName: Full=Caveolin-1 [Papio anubis]