Gene/Proteome Database (LMPD)
LMPD ID
LMP003411
Gene ID
Species
Mus musculus (Mouse)
Gene Name
perilipin 5
Gene Symbol
Synonyms
2310076L09Rik; AI415325; AW109675; Lsdp5; MLDP; PAT-1
Alternate Names
perilipin-5; myocardial LD protein; lipid storage droplet protein 5; lipid droplet associated protein; lipid droplet-associated protein PAT-1
Chromosome
17
Map Location
17 D|17
Proteins
| perilipin-5 | |
|---|---|
| Refseq ID | NP_001070816 |
| Protein GI | 116292164 |
| UniProt ID | Q8BVZ1 |
| mRNA ID | NM_001077348 |
| Length | 463 |
| RefSeq Status | VALIDATED |
| MDQRGEDTTLAPHSRMSGDQTAQDPGSSLGELDQQNVVNRVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVDLAQRGRRWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELIQHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALAGCVRGLPPSAQAKVAEVQRSVDALQATFADAHCLGDVAPTALAEGRGSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005829 | IDA:MGI | C | cytosol |
| GO:0005811 | IDA:UniProtKB | C | lipid particle |
| GO:0005739 | ISS:UniProtKB | C | mitochondrion |
| GO:0042802 | IPI:UniProtKB | F | identical protein binding |
| GO:0035473 | IPI:UniProtKB | F | lipase binding |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
| GO:0034389 | IMP:UniProtKB | P | lipid particle organization |
| GO:0019915 | IMP:UniProtKB | P | lipid storage |
| GO:0051646 | IMP:UniProtKB | P | mitochondrion localization |
| GO:0031999 | IDA:UniProtKB | P | negative regulation of fatty acid beta-oxidation |
| GO:0060192 | IMP:UniProtKB | P | negative regulation of lipase activity |
| GO:0050995 | IDA:UniProtKB | P | negative regulation of lipid catabolic process |
| GO:0035359 | IDA:UniProtKB | P | negative regulation of peroxisome proliferator activated receptor signaling pathway |
| GO:2000378 | IMP:UniProtKB | P | negative regulation of reactive oxygen species metabolic process |
| GO:0010897 | IDA:UniProtKB | P | negative regulation of triglyceride catabolic process |
| GO:0032000 | IDA:UniProtKB | P | positive regulation of fatty acid beta-oxidation |
| GO:0060193 | ISS:UniProtKB | P | positive regulation of lipase activity |
| GO:0010884 | ISS:UniProtKB | P | positive regulation of lipid storage |
| GO:0010890 | IDA:UniProtKB | P | positive regulation of sequestering of triglyceride |
| GO:0010867 | IDA:UniProtKB | P | positive regulation of triglyceride biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR004279 | Perilipin |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative initiation; Named isoforms=2; Name=1; IsoId=Q8BVZ1-1; Sequence=Displayed; Name=2; IsoId=Q8BVZ1-2; Sequence=VSP_034085; |
| Disruption Phenotype | No visible phenotype. Mice lack detectable lipid droplets in heart. The triacylglycerol and fatty acid content in heart is lower. {ECO:0000269|PubMed:22532565}. |
| Function | Lipid droplet-associated protein that maintains the balance between lipogenesis and lipolysis and also regulates fatty acid oxidation in oxidative tissues. Recruits mitochondria to the surface of lipid droplets and is involved in lipid droplet homeostasis by regulating both the storage of fatty acids in the form of triglycerides and the release of fatty acids for mitochondrial fatty acid oxidation. In lipid droplet triacylglycerol hydrolysis, plays a role as a scaffolding protein for three major key lipolytic players: ABHD5, PNPLA2 and LIPE. Reduces the triacylglycerol hydrolase activity of PNPLA2 by recruiting and sequestering PNPLA2 to lipid droplets. Phosphorylation by PKA enables lipolysis probably by promoting release of ABHD5 from the perilipin scaffold and by facilitating interaction of ABHD5 with PNPLA2. Also increases lipolysis through interaction with LIPE and upon PKA-mediated phosphorylation of LIPE. {ECO:0000269|PubMed:17130488, ECO:0000269|PubMed:19064991, ECO:0000269|PubMed:21393244, ECO:0000269|PubMed:21885430, ECO:0000269|PubMed:22532565, ECO:0000269|PubMed:22675471, ECO:0000269|PubMed:23345411}. |
| Induction | Up-regulated by fasting, PPARD, PPARA and PLIN4. Increased in muscle of high-fat diet fed mice. Induced by unsaturated long chain fatty acid in muscle. {ECO:0000269|PubMed:16571721, ECO:0000269|PubMed:17130488, ECO:0000269|PubMed:17234449, ECO:0000269|PubMed:23423172, ECO:0000269|PubMed:23606724}. |
| Ptm | Phosphorylated by PKA. Phosphorylated on serine in skeletal muscle at rest or with lipolytic stimulation. {ECO:0000269|PubMed:17242355, ECO:0000269|PubMed:21393244}. |
| Similarity | Belongs to the perilipin family. {ECO:0000305}. |
| Subcellular Location | Lipid droplet. Cytoplasm. Mitochondrion {ECO:0000250}. Note=Lipid droplet surface-associated. Exchanges between lipid droplets and the cytoplasm. |
| Subunit | Homooligomer. Interacts with PNPLA2; prevents interaction of PNPLA2 with ABHD5. Interacts with ABHD5; targets ABHD5 to lipid droplets and promotes interaction of ABHD5 with PNPLA2. Interacts with LIPE. {ECO:0000269|PubMed:19064991, ECO:0000269|PubMed:19717842, ECO:0000269|PubMed:21148142, ECO:0000269|PubMed:21393244}. |
| Tissue Specificity | Highly expressed in oxidative tissues, including heart, liver, brown adipose tissue (BAT) and slow-twitch fibers of skeletal muscle. Lower expression in epididymal white adipose tissue and anterior tibialis and quadriceps. Expressed in adrenal glands. Isoform 2 has the highest expression in heart. {ECO:0000269|PubMed:16571721, ECO:0000269|PubMed:17130488, ECO:0000269|PubMed:17234449}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003411 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 116292164 | RefSeq | NP_001070816 | 463 | perilipin-5 |
Identical Sequences to LMP003411 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116292164 | DBBJ | BAC36019.1 | 463 | unnamed protein product [Mus musculus] |
| GI:116292164 | GenBank | ABF13218.1 | 463 | lipid storage droplet protein 5 [Mus musculus] |
| GI:116292164 | GenBank | AAH24138.2 | 463 | RIKEN cDNA 2310076L09 gene [Mus musculus] |
| GI:116292164 | RefSeq | NP_080150.2 | 463 | perilipin-5 [Mus musculus] |
| GI:116292164 | SwissProt | Q8BVZ1.1 | 463 | RecName: Full=Perilipin-5; AltName: Full=Lipid droplet-associated protein PAT-1; AltName: Full=Lipid storage droplet protein 5; AltName: Full=Myocardial LD protein [Mus musculus] |
Related Sequences to LMP003411 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116292164 | GenBank | AAX12443.1 | 448 | lipid droplet associated protein [Mus musculus] |
| GI:116292164 | GenBank | EDL23718.1 | 448 | RIKEN cDNA 2310076L09 [Mus musculus] |
| GI:116292164 | GenBank | EDL83657.1 | 475 | similar to lipid droplet associated protein [Rattus norvegicus] |
| GI:116292164 | RefSeq | NP_001128109.1 | 475 | perilipin-5 [Rattus norvegicus] |
| GI:116292164 | RefSeq | XP_006524868.1 | 462 | PREDICTED: perilipin-5 isoform X1 [Mus musculus] |
| GI:116292164 | RefSeq | XP_008764992.1 | 463 | PREDICTED: perilipin-5 isoform X1 [Rattus norvegicus] |