Gene/Proteome Database (LMPD)

LMPD ID
LMP003587
Gene ID
1268
Species
Homo sapiens (Human)
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
CNR1
Synonyms
CANN6; CB-R; CB1; CB1A; CB1K5; CB1R; CNR
Alternate Names
cannabinoid receptor 1; central cannabinoid receptor
Chromosome
6
Map Location
6q14-q15
Summary
This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq, May 2009]
Orthologs
View orthologs and multiple alignments for CNR1

Proteins

cannabinoid receptor 1 isoform a
Refseq ID NP_001153698
Protein GI 237681067
UniProt ID P21554
mRNA ID NM_001160226
Length 472
RefSeq Status REVIEWED
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
cannabinoid receptor 1 isoform a
Refseq ID NP_057167
Protein GI 38683844
UniProt ID P21554
mRNA ID NM_016083
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:237681067 (mRNA isoform)
cannabinoid receptor 1 isoform a
Refseq ID NP_001153730
Protein GI 237681173
UniProt ID P21554
mRNA ID NM_001160258
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:237681067 (mRNA isoform)
cannabinoid receptor 1 isoform a
Refseq ID NP_001153731
Protein GI 237681175
UniProt ID P21554
mRNA ID NM_001160259
Length 472
RefSeq Status REVIEWED
Protein sequence is identical to GI:237681067 (mRNA isoform)
cannabinoid receptor 1 isoform b
Refseq ID NP_149421
Protein GI 237681065
UniProt ID P21554
mRNA ID NM_033181
Length 439
RefSeq Status REVIEWED
MKSILDGLADTTFRTITTDLLGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVFHRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Gene Information

Entrez Gene ID
1268
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
CNR1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 TAS:ProtInc C integral component of plasma membrane
GO:0005886 TAS:Reactome C plasma membrane
GO:0004949 IDA:UniProtKB F cannabinoid receptor activity
GO:0008144 IEA:Ensembl F drug binding
GO:0007187 TAS:ProtInc P G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger
GO:0007188 IDA:UniProtKB P adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007568 IEA:Ensembl P aging
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0060135 IEA:Ensembl P maternal process involved in female pregnancy
GO:0007613 IEA:Ensembl P memory
GO:0045759 IEA:Ensembl P negative regulation of action potential
GO:0045776 IEA:Ensembl P negative regulation of blood pressure
GO:0033602 IEA:Ensembl P negative regulation of dopamine secretion
GO:0031999 IEA:Ensembl P negative regulation of fatty acid beta-oxidation
GO:0033004 IEA:Ensembl P negative regulation of mast cell activation
GO:0051001 IEA:Ensembl P negative regulation of nitric-oxide synthase activity
GO:0002866 IEA:Ensembl P positive regulation of acute inflammatory response to antigenic stimulus
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0045777 IEA:Ensembl P positive regulation of blood pressure
GO:0031622 IEA:Ensembl P positive regulation of fever generation
GO:0010976 IEA:Ensembl P positive regulation of neuron projection development
GO:0060259 IEA:Ensembl P regulation of feeding behavior
GO:0050796 IEA:Ensembl P regulation of insulin secretion
GO:0060405 IEA:Ensembl P regulation of penile erection
GO:0032228 IEA:Ensembl P regulation of synaptic transmission, GABAergic
GO:0051966 IEA:Ensembl P regulation of synaptic transmission, glutamatergic
GO:0042220 IEA:Ensembl P response to cocaine
GO:0045471 IEA:Ensembl P response to ethanol
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0043278 IEA:Ensembl P response to morphine
GO:0035094 IEA:Ensembl P response to nicotine
GO:0007584 IEA:Ensembl P response to nutrient
GO:0019233 IEA:Ensembl P sensory perception of pain
GO:0007283 IEA:Ensembl P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
hsa04015 Rap1 signaling pathway
hsa04723 Retrograde endocannabinoid signaling

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR000810 Cannabinoid receptor type 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 1 (brain)
Protein Entry
CNR1_HUMAN
UniProt ID
P21554
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=Long; IsoId=P21554-1; Sequence=Displayed; Name=2; Synonyms=CB1a, Short; IsoId=P21554-2; Sequence=VSP_001868; Note=Dubious isoform. A putative downstream initiation AUG is used to produce isoform 2 (PubMed:1718258). The use of the first AUG (same as isoform 1) gives a truncated protein of 36 AA. ; Name=3; Synonyms=CB1b; IsoId=P21554-3; Sequence=VSP_016529;
Function Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current. Isoform 2 and isoform 3 have altered ligand binding.
Ptm Palmitoylation at Cys-415 is important for recruitment at both plasma membrane and lipid rafts.
Similarity Belongs to the G-protein coupled receptor 1 family.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Subunit Interacts (via C-terminus) with CNRIP1.
Tissue Specificity Widely expressed.

Identical and Related Proteins

Unique RefSeq proteins for LMP003587 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
237681067 RefSeq NP_001153698 472 cannabinoid receptor 1 isoform a
237681065 RefSeq NP_149421 439 cannabinoid receptor 1 isoform b

Identical Sequences to LMP003587 proteins

Reference Database Accession Length Protein Name
GI:237681065 GenBank AAV35030.1 439 cannabinoid receptor 1 splice variant CB1b [Homo sapiens]
GI:237681065 GenBank AGW25490.1 439 cannabinoid receptor 1 transcript variant 2 [Homo sapiens]
GI:237681065 RefSeq XP_002817182.1 439 PREDICTED: cannabinoid receptor 1 isoform X2 [Pongo abelii]
GI:237681065 RefSeq XP_005552448.1 439 PREDICTED: cannabinoid receptor 1 isoform X5 [Macaca fascicularis]
GI:237681067 RefSeq XP_010360492.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681067 RefSeq XP_010360493.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681067 RefSeq XP_010360494.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681067 RefSeq XP_010360495.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681067 RefSeq XP_010360496.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681067 RefSeq XP_010360497.1 472 PREDICTED: cannabinoid receptor 1 isoform X1 [Rhinopithecus roxellana]
GI:237681065 RefSeq XP_010360498.1 439 PREDICTED: cannabinoid receptor 1 isoform X2 [Rhinopithecus roxellana]

Related Sequences to LMP003587 proteins

Reference Database Accession Length Protein Name
GI:237681067 EMBL CBJ06631.1 857 unnamed protein product, partial [synthetic construct]
GI:237681067 GenBank ACC29788.1 471 Sequence 89 from patent US 7348140
GI:237681065 RefSeq XP_004044440.1 439 PREDICTED: cannabinoid receptor 1 isoform 1 [Gorilla gorilla gorilla]
GI:237681065 RefSeq XP_005210945.1 439 PREDICTED: cannabinoid receptor 1 isoform X4 [Bos taurus]
GI:237681065 RefSeq XP_005684752.1 439 PREDICTED: cannabinoid receptor 1 isoform X2 [Capra hircus]
GI:237681065 RefSeq XP_005889359.1 439 PREDICTED: cannabinoid receptor 1 isoform X2 [Bos mutus]
GI:237681065 RefSeq XP_005983702.1 439 PREDICTED: cannabinoid receptor 1 isoform X3 [Pantholops hodgsonii]
GI:237681065 RefSeq XP_006058144.1 439 PREDICTED: cannabinoid receptor 1 isoform X3 [Bubalus bubalis]
GI:237681067 RefSeq XP_008004757.1 472 PREDICTED: cannabinoid receptor 1 [Chlorocebus sabaeus]
GI:237681067 RefSeq XP_008004758.1 472 PREDICTED: cannabinoid receptor 1 [Chlorocebus sabaeus]
GI:237681067 RefSeq XP_008004759.1 472 PREDICTED: cannabinoid receptor 1 [Chlorocebus sabaeus]
GI:237681067 RefSeq XP_008004760.1 472 PREDICTED: cannabinoid receptor 1 [Chlorocebus sabaeus]