Gene/Proteome Database (LMPD)

LMPD ID
LMP003591
Gene ID
12034
Species
Mus musculus (Mouse)
Gene Name
prohibitin 2
Gene Symbol
Phb2
Synonyms
AU044498; BAP; Bap37; Bcap37; REA
Chromosome
6
Map Location
6 F2|6 59.17 cM

Proteins

prohibitin-2
Refseq ID NP_031557
Protein GI 126723336
UniProt ID O35129
mRNA ID NM_007531
Length 299
RefSeq Status VALIDATED
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Gene Information

Entrez Gene ID
12034
Gene Name
prohibitin 2
Gene Symbol
Phb2
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005743 IDA:UniProtKB C mitochondrial inner membrane
GO:0005739 IDA:UniProtKB C mitochondrion
GO:0016363 ISS:UniProtKB C nuclear matrix
GO:0005634 IDA:UniProtKB C nucleus
GO:0043234 ISS:UniProtKB C protein complex
GO:0060749 IMP:MGI P mammary gland alveolus development
GO:0060744 IMP:MGI P mammary gland branching involved in thelarche
GO:0033147 IMP:MGI P negative regulation of intracellular estrogen receptor signaling pathway
GO:0033600 IMP:MGI P negative regulation of mammary gland epithelial cell proliferation
GO:0045892 IDA:UniProtKB P negative regulation of transcription, DNA-templated
GO:0060762 IMP:MGI P regulation of branching involved in mammary gland duct morphogenesis
GO:0006351 IEA:UniProtKB-KW P transcription, DNA-templated

Domain Information

InterPro Annotations

Accession Description
IPR001107 Band 7 protein
IPR000163 Prohibitin

UniProt Annotations

Entry Information

Gene Name
prohibitin 2
Protein Entry
O35129_MOUSE
UniProt ID
O35129
Species
Mouse

Comments

Comment Type Description
Developmental Stage Throughout gestation, highly expressed in brown fat, heart, liver, developing renal tubules and neurons, and detected at lower levels in tissues such as lung and exocrine pancreas.
Function Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases. Functions as an estrogen receptor (ER)-selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging. {ECO:0000250|UniProtKB:Q99623, ECO:0000269|PubMed:12878603, ECO:0000269|PubMed:15140878}.
Similarity Belongs to the prohibitin family.
Subcellular Location Mitochondrion inner membrane. Cytoplasm. Nucleus. Note=Also cytoplasmic and nuclear.
Subunit Interacts with ZNF703 (By similarity). Interacts with STOML2 (By similarity). Interacts with PHB, ESR1, HDAC1 and HDAC5. {ECO:0000250, ECO:0000269|PubMed:11302691, ECO:0000269|PubMed:12878603, ECO:0000269|PubMed:15140878}.
Tissue Specificity Widely expressed in different tissues. {ECO:0000269|PubMed:11302691, ECO:0000269|PubMed:15140878, ECO:0000269|PubMed:8070406}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003591 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
126723336 RefSeq NP_031557 299 prohibitin-2

Identical Sequences to LMP003591 proteins

Reference Database Accession Length Protein Name
GI:126723336 EMBL CEF39417.1 299 unnamed protein product [Homo sapiens]
GI:126723336 GenBank AHD74977.1 299 Sequence 15681 from patent US 8586006
GI:126723336 GenBank AIC50867.1 299 PHB2, partial [synthetic construct]
GI:126723336 RefSeq XP_007965638.1 299 PREDICTED: prohibitin-2 [Chlorocebus sabaeus]
GI:126723336 RefSeq XP_008823581.1 299 PREDICTED: prohibitin-2 [Nannospalax galili]
GI:126723336 RefSeq XP_010384185.1 299 PREDICTED: prohibitin-2 [Rhinopithecus roxellana]

Related Sequences to LMP003591 proteins

Reference Database Accession Length Protein Name
GI:126723336 GenBank AAH83705.1 299 Prohibitin 2 [Rattus norvegicus]
GI:126723336 RefSeq NP_001013053.1 299 prohibitin-2 [Rattus norvegicus]
GI:126723336 RefSeq XP_004909543.1 299 PREDICTED: prohibitin-2 isoform X1 [Heterocephalus glaber]
GI:126723336 RefSeq XP_004869532.1 299 PREDICTED: prohibitin-2 isoform X1 [Heterocephalus glaber]
GI:126723336 RefSeq XP_005338365.1 299 PREDICTED: prohibitin-2 isoform X1 [Ictidomys tridecemlineatus]
GI:126723336 SwissProt Q5XIH7.1 299 RecName: Full=Prohibitin-2; AltName: Full=B-cell receptor-associated protein BAP37; Short=BAP-37 [Rattus norvegicus]