Gene/Proteome Database (LMPD)
LMPD ID
LMP003612
Gene ID
Species
Mus musculus (Mouse)
Gene Name
vitamin K epoxide reductase complex, subunit 1
Gene Symbol
Synonyms
D7Wsu86e
Alternate Names
vitamin K epoxide reductase complex subunit 1; phylloquinone epoxide reductase; vitamin K1 2,3-epoxide reductase subunit 1; vitamin K1 epoxide reductase (warfarin-sensitive)
Chromosome
7
Map Location
7 F3|7 69.81 cM
EC Number
1.1.4.1
Summary
Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| vitamin K epoxide reductase complex subunit 1 precursor | |
|---|---|
| Refseq ID | NP_848715 |
| Protein GI | 30519915 |
| UniProt ID | Q9CRC0 |
| mRNA ID | NM_178600 |
| Length | 161 |
| RefSeq Status | REVIEWED |
| MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHMLGADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYAINVGLMLLSFQKVPEHKTKKH | |
| sig_peptide: 1..31 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3283 peptide sequence: MGTTWRSPGLVRLALCLAGLALSLYALHVKA | |
Gene Information
Entrez Gene ID
Gene Name
vitamin K epoxide reductase complex, subunit 1
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | ISA:MGI | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0048038 | IEA:UniProtKB-KW | F | quinone binding |
| GO:0047057 | IDA:MGI | F | vitamin-K-epoxide reductase (warfarin-sensitive) activity |
| GO:0007596 | IMP:UniProtKB | P | blood coagulation |
| GO:0060348 | IMP:UniProtKB | P | bone development |
| GO:0017187 | ISS:UniProtKB | P | peptidyl-glutamic acid carboxylation |
| GO:0050820 | IMP:MGI | P | positive regulation of coagulation |
| GO:0042371 | ISA:MGI | P | vitamin K biosynthetic process |
| GO:0042373 | IMP:UniProtKB | P | vitamin K metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
| mmu00130 | Ubiquinone and other terpenoid-quinone biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR012932 | Vitamin K epoxide reductase |
UniProt Annotations
Entry Information
Gene Name
vitamin K epoxide reductase complex, subunit 1
Protein Entry
VKOR1_MOUSE
UniProt ID
Species
Mouse
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2-methyl-3-phytyl-1,4-naphthoquinone + oxidized dithiothreitol = 2,3-epoxy-2,3-dihydro-2-methyl-3-phytyl- 1,4-naphthoquinone + 1,4-dithiothreitol. |
| Disruption Phenotype | Mice are born at the expected Mendelian rate and appear normal, but die between one and twenty days after birth, due to severe bleeeding. In about 75% of the cases, subdural bleeding is observed, in addition to intracerebral and intramuscular bleeding. Daily oral administration of vitamin K to the mutant mice leads to normal survival, but the mice die within seven days after the cessation of vitamin K administration. Besides, both homozygous and heterozygous mutant mice display defects in bone development with reduced length of the calcified part of the long bones in front and hind limbs. {ECO:0000269|PubMed:19492146}. |
| Domain | The number of transmembrane domains and the membrane topology are controversial; supporting evidence is available both for models with three transmembrane domains and four transmembrane domains. {ECO:0000250}. |
| Enzyme Regulation | Inhibited by warfarin (coumadin). {ECO:0000269|PubMed:15879509}. |
| Function | Involved in vitamin K metabolism. Catalytic subunit of the vitamin K epoxide reductase (VKOR) complex which reduces inactive vitamin K 2,3-epoxide to active vitamin K. Vitamin K is required for the gamma-carboxylation of various proteins, including clotting factors, and is required for normal blood coagulation, but also for normal bone development. {ECO:0000269|PubMed:15879509, ECO:0000269|PubMed:19492146}. |
| Miscellaneous | The location of two cysteine active-site residues within a proposed transmembrane is consistent both with the known hydrophobic environment of the thiol redox site of the enzyme and with the lipophilicity of vitamin K and warfarin (coumadin). |
| Similarity | Belongs to the VKOR family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
| Tissue Specificity | Detected in liver. {ECO:0000269|PubMed:19492146}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003612 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 30519915 | RefSeq | NP_848715 | 161 | vitamin K epoxide reductase complex subunit 1 precursor |
Identical Sequences to LMP003612 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30519915 | GenBank | EDL17600.1 | 161 | vitamin K epoxide reductase complex, subunit 1, isoform CRA_a [Mus musculus] |
| GI:30519915 | GenBank | ADN33371.1 | 161 | vitamin K epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94695.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94696.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | AEF74458.1 | 161 | Sequence 17 from patent US 7939250 |
| GI:30519915 | SwissProt | Q9CRC0.1 | 161 | RecName: Full=Vitamin K epoxide reductase complex subunit 1; AltName: Full=Vitamin K1 2,3-epoxide reductase subunit 1 [Mus musculus] |
Related Sequences to LMP003612 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:30519915 | GenBank | ADN33370.1 | 161 | vitamin K epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN33373.1 | 161 | vitamin K epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94692.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94693.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94697.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |
| GI:30519915 | GenBank | ADN94698.1 | 161 | vitamin K 2,3-epoxide reductase complex subunit 1 [Mus musculus domesticus] |