Gene/Proteome Database (LMPD)

LMPD ID
LMP003644
Gene ID
11727
Species
Mus musculus (Mouse)
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Gene Symbol
Ang
Synonyms
AI385586; Ang1; Rnase5; Rnase5a
Alternate Names
angiogenin; RNase 5; angiogenin-1; ribonuclease 5; angiogenin, ribonuclease A family, member 1
Chromosome
14
Map Location
14 B-C1|14 26.37 cM
EC Number
3.1.27.-
Summary
This gene encodes a member of the pancreatic ribonuclease A superfamily and is a potent inducer of neovascularization. The encoded protein is a secreted multifunctional tRNA-specific ribonuclease that promotes angiogenesis in response to angiogenetic stimuli such as hypoxia, mediates stress-induced translational repression by cleaving cellular tRNAs, stimulates cell proliferation by mediating rRNA transcription in prostate cancer cells, and is involved in neurite pathfinding. This gene resides in a cluster of highly related genes. It shares dual promoters and 5' exons with the ribonuclease, RNase A family 4 gene. Two alternatively spliced variants, with different 5' exons but the same coding exon, have been identified. Multiple pseudogenes have been found for this gene. [provided by RefSeq, Jun 2009]
Orthologs
View orthologs and multiple alignments for Ang

Proteins

angiogenin precursor
Refseq ID NP_001155203
Protein GI 239835771
UniProt ID P21570
mRNA ID NM_001161731
Length 145
RefSeq Status REVIEWED
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL
angiogenin precursor
Refseq ID NP_031473
Protein GI 6680688
UniProt ID P21570
mRNA ID NM_007447
Length 145
RefSeq Status REVIEWED
Protein sequence is identical to GI:239835771 (mRNA isoform)
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2479 peptide sequence: MAISPGPLFLIFVLGLVVIPPTLA mat_peptide: 25..145 product: angiogenin calculated_mol_wt: 13767 peptide sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2479 peptide sequence: MAISPGPLFLIFVLGLVVIPPTLA mat_peptide: 25..145 product: angiogenin calculated_mol_wt: 13767 peptide sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL

Gene Information

Entrez Gene ID
11727
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Gene Symbol
Ang
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0032311 ISS:UniProtKB C angiogenin-PRI complex
GO:0005605 ISS:UniProtKB C basal lamina
GO:0005576 TAS:Reactome C extracellular region
GO:0005615 ISS:UniProtKB C extracellular space
GO:0030426 IDA:UniProtKB C growth cone
GO:0043025 IDA:UniProtKB C neuronal cell body
GO:0005730 ISS:UniProtKB C nucleolus
GO:0005634 ISS:UniProtKB C nucleus
GO:0003677 IEA:UniProtKB-KW F DNA binding
GO:0003723 IC:MGI F RNA binding
GO:0003779 ISS:UniProtKB F actin binding
GO:0005507 ISS:UniProtKB F copper ion binding
GO:0004519 IEA:UniProtKB-KW F endonuclease activity
GO:0008201 ISS:UniProtKB F heparin binding
GO:0005102 ISS:UniProtKB F receptor binding
GO:0004540 ISS:UniProtKB F ribonuclease activity
GO:0090501 IDA:GOC P RNA phosphodiester bond hydrolysis
GO:0030041 ISS:UniProtKB P actin filament polymerization
GO:0032431 ISS:UniProtKB P activation of phospholipase A2 activity
GO:0007202 ISS:UniProtKB P activation of phospholipase C activity
GO:0001525 ISS:UniProtKB P angiogenesis
GO:0030154 IEA:UniProtKB-KW P cell differentiation
GO:0007417 NAS:UniProtKB P central nervous system development
GO:0006651 ISS:UniProtKB P diacylglycerol biosynthetic process
GO:0048662 ISS:UniProtKB P negative regulation of smooth muscle cell proliferation
GO:0017148 IEA:UniProtKB-KW P negative regulation of translation
GO:0001938 ISS:UniProtKB P positive regulation of endothelial cell proliferation
GO:0050714 ISS:UniProtKB P positive regulation of protein secretion
GO:0009303 ISS:UniProtKB P rRNA transcription
GO:0001666 ISS:UniProtKB P response to hypoxia

Domain Information

InterPro Annotations

Accession Description
IPR001427 Pancreatic ribonuclease
IPR023411 Ribonuclease A, active site
IPR023412 Ribonuclease A-domain

UniProt Annotations

Entry Information

Gene Name
angiogenin, ribonuclease, RNase A family, 5
Protein Entry
ANGI_MOUSE
UniProt ID
P21570
Species
Mouse

Comments

Comment Type Description
Function Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo (By similarity). {ECO:0000250}.
Similarity Belongs to the pancreatic ribonuclease family. {ECO:0000305}.
Subcellular Location Secreted, extracellular space, extracellular matrix, basement membrane {ECO:0000250}. Nucleus, nucleolus {ECO:0000250}. Note=Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA. {ECO:0000250}.
Subunit Interacts with and forms a tight 1:1 complex with RNH1. Dimerization of two such complexes may occur (By similarity). {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP003644 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
239835771 RefSeq NP_001155203 145 angiogenin precursor

Identical Sequences to LMP003644 proteins

Reference Database Accession Length Protein Name
GI:239835771 DBBJ BAE42343.1 145 unnamed protein product [Mus musculus]
GI:239835771 DBBJ BAE35521.1 145 unnamed protein product [Mus musculus]
GI:239835771 GenBank AAH55355.1 145 Angiogenin, ribonuclease, RNase A family, 5 [Mus musculus]
GI:239835771 GenBank EDL20841.1 145 mCG16519, isoform CRA_a [Mus musculus]
GI:239835771 GenBank EDL20844.1 145 mCG16519, isoform CRA_a [Mus musculus]
GI:239835771 RefSeq NP_031473.1 145 angiogenin precursor [Mus musculus]

Related Sequences to LMP003644 proteins

Reference Database Accession Length Protein Name
GI:239835771 GenBank AAV87193.1 145 angiogenin ribonuclease 1 [Rattus norvegicus]
GI:239835771 GenBank EDL88436.1 145 ribonuclease, RNase A family 4, isoform CRA_a [Rattus norvegicus]
GI:239835771 PDB 2BWK 121 Chain A, Murine Angiogenin, Sulphate Complex
GI:239835771 PDB 2BWL 121 Chain A, Murine Angiogenin, Phosphate Complex
GI:239835771 PRF - 121 angiogenin [Mus musculus]
GI:239835771 tpe CDG32031.1 145 TPA: ribonuclease A a1 [Rattus norvegicus]