Gene/Proteome Database (LMPD)
LMPD ID
LMP003644
Gene ID
Species
Mus musculus (Mouse)
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Gene Symbol
Synonyms
AI385586; Ang1; Rnase5; Rnase5a
Alternate Names
angiogenin; RNase 5; angiogenin-1; ribonuclease 5; angiogenin, ribonuclease A family, member 1
Chromosome
14
Map Location
14 B-C1|14 26.37 cM
EC Number
3.1.27.-
Summary
This gene encodes a member of the pancreatic ribonuclease A superfamily and is a potent inducer of neovascularization. The encoded protein is a secreted multifunctional tRNA-specific ribonuclease that promotes angiogenesis in response to angiogenetic stimuli such as hypoxia, mediates stress-induced translational repression by cleaving cellular tRNAs, stimulates cell proliferation by mediating rRNA transcription in prostate cancer cells, and is involved in neurite pathfinding. This gene resides in a cluster of highly related genes. It shares dual promoters and 5' exons with the ribonuclease, RNase A family 4 gene. Two alternatively spliced variants, with different 5' exons but the same coding exon, have been identified. Multiple pseudogenes have been found for this gene. [provided by RefSeq, Jun 2009]
Orthologs
Proteins
angiogenin precursor | |
---|---|
Refseq ID | NP_001155203 |
Protein GI | 239835771 |
UniProt ID | P21570 |
mRNA ID | NM_001161731 |
Length | 145 |
RefSeq Status | REVIEWED |
MAISPGPLFLIFVLGLVVIPPTLAQDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL |
angiogenin precursor | |
---|---|
Refseq ID | NP_031473 |
Protein GI | 6680688 |
UniProt ID | P21570 |
mRNA ID | NM_007447 |
Length | 145 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:239835771 (mRNA isoform) | |
sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2479 peptide sequence: MAISPGPLFLIFVLGLVVIPPTLA mat_peptide: 25..145 product: angiogenin calculated_mol_wt: 13767 peptide sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL sig_peptide: 1..24 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2479 peptide sequence: MAISPGPLFLIFVLGLVVIPPTLA mat_peptide: 25..145 product: angiogenin calculated_mol_wt: 13767 peptide sequence: QDDSRYTKFLTQHHDAKPKGRDDRYCERMMKRRSLTSPCKDVNTFIHGNKSNIKAICGANGSPYRENLRMSKSPFQVTTCKHTGGSPRPPCQYRASAGFRHVVIACENGLPVHFDESFFSL |
Gene Information
Entrez Gene ID
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0032311 | ISS:UniProtKB | C | angiogenin-PRI complex |
GO:0005605 | ISS:UniProtKB | C | basal lamina |
GO:0005576 | TAS:Reactome | C | extracellular region |
GO:0005615 | ISS:UniProtKB | C | extracellular space |
GO:0030426 | IDA:UniProtKB | C | growth cone |
GO:0043025 | IDA:UniProtKB | C | neuronal cell body |
GO:0005730 | ISS:UniProtKB | C | nucleolus |
GO:0005634 | ISS:UniProtKB | C | nucleus |
GO:0003779 | ISS:UniProtKB | F | actin binding |
GO:0005507 | ISS:UniProtKB | F | copper ion binding |
GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
GO:0004519 | IEA:UniProtKB-KW | F | endonuclease activity |
GO:0008201 | ISS:UniProtKB | F | heparin binding |
GO:0005102 | ISS:UniProtKB | F | receptor binding |
GO:0004540 | ISS:UniProtKB | F | ribonuclease activity |
GO:0003723 | IC:MGI | F | RNA binding |
GO:0030041 | ISS:UniProtKB | P | actin filament polymerization |
GO:0032431 | ISS:UniProtKB | P | activation of phospholipase A2 activity |
GO:0007202 | ISS:UniProtKB | P | activation of phospholipase C activity |
GO:0001525 | ISS:UniProtKB | P | angiogenesis |
GO:0030154 | IEA:UniProtKB-KW | P | cell differentiation |
GO:0007417 | NAS:UniProtKB | P | central nervous system development |
GO:0006651 | ISS:UniProtKB | P | diacylglycerol biosynthetic process |
GO:0048662 | ISS:UniProtKB | P | negative regulation of smooth muscle cell proliferation |
GO:0017148 | IEA:UniProtKB-KW | P | negative regulation of translation |
GO:0001938 | ISS:UniProtKB | P | positive regulation of endothelial cell proliferation |
GO:0050714 | ISS:UniProtKB | P | positive regulation of protein secretion |
GO:0001666 | ISS:UniProtKB | P | response to hypoxia |
GO:0090501 | IDA:GOC | P | RNA phosphodiester bond hydrolysis |
GO:0009303 | ISS:UniProtKB | P | rRNA transcription |
Domain Information
UniProt Annotations
Entry Information
Gene Name
angiogenin, ribonuclease, RNase A family, 5
Protein Entry
ANGI_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Function | Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo (By similarity). {ECO:0000250}. |
Similarity | Belongs to the pancreatic ribonuclease family. {ECO:0000305}. |
Subcellular Location | Secreted, extracellular space, extracellular matrix, basement membrane {ECO:0000250}. Nucleus, nucleolus {ECO:0000250}. Note=Rapidly endocytosed by target cells and translocated to the nucleus where it accumulates in the nucleolus and binds to DNA. {ECO:0000250}. |
Subunit | Interacts with and forms a tight 1:1 complex with RNH1. Dimerization of two such complexes may occur (By similarity). {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003644 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
239835771 | RefSeq | NP_001155203 | 145 | angiogenin precursor |
Identical Sequences to LMP003644 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:239835771 | DBBJ | BAE42343.1 | 145 | unnamed protein product [Mus musculus] |
GI:239835771 | DBBJ | BAE35521.1 | 145 | unnamed protein product [Mus musculus] |
GI:239835771 | GenBank | AAH55355.1 | 145 | Angiogenin, ribonuclease, RNase A family, 5 [Mus musculus] |
GI:239835771 | GenBank | EDL20841.1 | 145 | mCG16519, isoform CRA_a [Mus musculus] |
GI:239835771 | GenBank | EDL20844.1 | 145 | mCG16519, isoform CRA_a [Mus musculus] |
GI:239835771 | RefSeq | NP_031473.1 | 145 | angiogenin precursor [Mus musculus] |
Related Sequences to LMP003644 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:239835771 | GenBank | AAV87193.1 | 145 | angiogenin ribonuclease 1 [Rattus norvegicus] |
GI:239835771 | GenBank | EDL88436.1 | 145 | ribonuclease, RNase A family 4, isoform CRA_a [Rattus norvegicus] |
GI:239835771 | PDB | 2BWK | 121 | Chain A, Murine Angiogenin, Sulphate Complex |
GI:239835771 | PDB | 2BWL | 121 | Chain A, Murine Angiogenin, Phosphate Complex |
GI:239835771 | PRF | - | 121 | angiogenin [Mus musculus] |
GI:239835771 | tpe | CDG32031.1 | 145 | TPA: ribonuclease A a1 [Rattus norvegicus] |