Gene/Proteome Database (LMPD)
LMPD ID
LMP003675
Gene ID
Species
Homo sapiens (Human)
Gene Name
free fatty acid receptor 2
Gene Symbol
Synonyms
FFA2R; GPR43
Chromosome
19
Map Location
19q13.1
Summary
This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq, Apr 2009]
Orthologs
Proteins
free fatty acid receptor 2 | |
---|---|
Refseq ID | NP_005297 |
Protein GI | 4885333 |
UniProt ID | O15552 |
mRNA ID | NM_005306 |
Length | 330 |
RefSeq Status | REVIEWED |
MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042995 | IEA:Ensembl | C | cell projection |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0004930 | IEA:UniProtKB-KW | F | G-protein coupled receptor activity |
GO:0071398 | IEA:Ensembl | P | cellular response to fatty acid |
KEGG Pathway Links
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_21268 | Free fatty acid receptors |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP003675 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4885333 | RefSeq | NP_005297 | 330 | free fatty acid receptor 2 |
Identical Sequences to LMP003675 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4885333 | DBBJ | BAH86809.1 | 330 | free fatty acid receptor 2 [Homo sapiens] |
GI:4885333 | GenBank | ABY09760.1 | 330 | Sequence 2 from patent US 7303889 |
GI:4885333 | GenBank | ABY87913.1 | 330 | free fatty acid receptor 2 [Homo sapiens] |
GI:4885333 | GenBank | ACH30195.1 | 330 | Sequence 258 from patent US 7410777 |
GI:4885333 | GenBank | AHD75704.1 | 330 | Sequence 18087 from patent US 8586006 |
GI:4885333 | GenBank | AIC48877.1 | 330 | FFAR2, partial [synthetic construct] |
Related Sequences to LMP003675 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4885333 | DBBJ | BAG74050.1 | 330 | free fatty acid receptor 2, partial [synthetic construct] |
GI:4885333 | GenBank | AAP64878.1 | 330 | Sequence 276 from patent US 6555339 |
GI:4885333 | GenBank | AAH96201.1 | 330 | Free fatty acid receptor 2 [Homo sapiens] |
GI:4885333 | GenBank | AAH95535.1 | 329 | FFAR2 protein, partial [Homo sapiens] |
GI:4885333 | GenBank | ACH30200.1 | 330 | Sequence 276 from patent US 7410777 |
GI:4885333 | RefSeq | XP_003816199.1 | 330 | PREDICTED: free fatty acid receptor 2 [Pan paniscus] |