Gene/Proteome Database (LMPD)
Proteins
| apolipoprotein N precursor | |
|---|---|
| Refseq ID | NP_598757 |
| Protein GI | 19527214 |
| UniProt ID | G3X9D6 |
| mRNA ID | NM_133996 |
| Length | 251 |
| RefSeq Status | VALIDATED |
| MIQAALLLGCILLSPVTAFPWKTQNGSLPAVTRTEPTSNVLPNKIPPPTPITCRDLLYTVLPAAPLSEFLSLLALRVVLENIGCPAEAYSLQLRISEMGGKDSAETLVLQSQKSSQEEGIGNNEVILRHLVPSPGDMRRVRRSVTLPEACTYEPGWVLYDMAQVLLETANKLPPIDLVREFKASVVNVTQHCTMESWESMNEVARRLMSSPELKDAKIPVEDRVYLVAQLAVVLKRIFVNLVWEYFQTYFG | |
| sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1827 peptide sequence: MIQAALLLGCILLSPVTA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | ISA:MGI | C | cytoplasm |
| GO:0005615 | ISA:MGI | C | extracellular space |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR026114 | Apolipoprotein F |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP003723 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 19527214 | RefSeq | NP_598757 | 251 | apolipoprotein N precursor |
Identical Sequences to LMP003723 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19527214 | GenBank | EDL24550.1 | 251 | apolipoprotein N, isoform CRA_a [Mus musculus] |
| GI:19527214 | GenBank | EDL24551.1 | 251 | apolipoprotein N, isoform CRA_a [Mus musculus] |
Related Sequences to LMP003723 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:19527214 | DBBJ | BAC38845.1 | 227 | unnamed protein product [Mus musculus] |
| GI:19527214 | GenBank | AAH88168.1 | 255 | Apolipoprotein N [Rattus norvegicus] |
| GI:19527214 | GenBank | EDL84879.1 | 255 | similar to apolipoprotein F-like [Rattus norvegicus] |
| GI:19527214 | RefSeq | NP_001009385.1 | 255 | apolipoprotein N precursor [Rattus norvegicus] |
| GI:19527214 | RefSeq | XP_006987414.1 | 254 | PREDICTED: apolipoprotein F-like [Peromyscus maniculatus bairdii] |
| GI:19527214 | RefSeq | XP_008820912.1 | 254 | PREDICTED: apolipoprotein F-like [Nannospalax galili] |