Gene/Proteome Database (LMPD)

LMPD ID
LMP003729
Gene ID
338328
Species
Homo sapiens (Human)
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
GPIHBP1
Synonyms
GPI-HBP1; HYPL1D
Alternate Names
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; endothelial cell LPL transporter; GPI-anchored HDL-binding protein 1; GPI anchored high density lipoprotein binding protein 1
Chromosome
8
Map Location
8q24.3
Summary
This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Orthologs
View orthologs and multiple alignments for GPIHBP1

Proteins

glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 1 precursor
Refseq ID NP_835466
Protein GI 613410183
UniProt ID Q8IV16
mRNA ID NM_178172
Length 184
RefSeq Status REVIEWED
MKALGAVLLALLLFGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP
sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2054 peptide sequence: MKALGAVLLALLLFGRPGRG sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2054 peptide sequence: MKALGAVLLALLLFGRPGRG mat_peptide: 21..151 product: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8IV16.2) calculated_mol_wt: 14713 peptide sequence: QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG

Gene Information

Entrez Gene ID
338328
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
GPIHBP1
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031362 IDA:BHF-UCL C anchored component of external side of plasma membrane
GO:0016324 ISS:BHF-UCL C apical plasma membrane
GO:0016323 ISS:BHF-UCL C basolateral plasma membrane
GO:0009897 IDA:BHF-UCL C external side of plasma membrane
GO:0034364 IEA:UniProtKB-KW C high-density lipoprotein particle
GO:0035478 IDA:BHF-UCL F chylomicron binding
GO:0035473 IPI:BHF-UCL F lipase binding
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0071813 IDA:UniProtKB F lipoprotein particle binding
GO:0008320 ISS:BHF-UCL F protein transmembrane transporter activity
GO:0042632 ISS:BHF-UCL P cholesterol homeostasis
GO:0006886 ISS:BHF-UCL P intracellular protein transport
GO:0090321 ISS:BHF-UCL P positive regulation of chylomicron remnant clearance
GO:0051006 IMP:BHF-UCL P positive regulation of lipoprotein lipase activity
GO:0017038 ISS:BHF-UCL P protein import
GO:0034394 ISS:BHF-UCL P protein localization to cell surface
GO:0050821 ISS:BHF-UCL P protein stabilization
GO:0071806 ISS:GOC P protein transmembrane transport
GO:0071503 IMP:BHF-UCL P response to heparin
GO:0045056 ISS:BHF-UCL P transcytosis
GO:0070328 IMP:BHF-UCL P triglyceride homeostasis

Domain Information

InterPro Annotations

Accession Description
IPR001526 CD59 antigen
IPR016054 Ly-6 antigen / uPA receptor -like

UniProt Annotations

Entry Information

Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Protein Entry
HDBP1_HUMAN
UniProt ID
Q8IV16
Species
Human

Comments

Comment Type Description
Function Plays a key role in the lipolytic processing of chylomicrons. Required for the transport of lipoprotein lipase LPL into the capillary lumen (By similarity).
Polymorphism The missense variant Arg-56 may be associated with severe hypertriglyceridemia and chylomicronemia.
Ptm Glycosylation of Asn-78 is critical for cell surface localization and the binding of chylomicrons and lipoprotein lipase.
Similarity Contains 1 UPAR/Ly6 domain.
Subcellular Location Apical cell membrane ; Lipid- anchor, GPI-anchor . Basolateral cell membrane {ECO
Subunit Binds with high affinity to high-density lipoprotein (HDL) (By similarity). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5.

Identical and Related Proteins

Unique RefSeq proteins for LMP003729 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
613410183 RefSeq NP_835466 184 glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 1 precursor

Identical Sequences to LMP003729 proteins

Reference Database Accession Length Protein Name
GI:613410183 GenBank AAH63857.1 184 Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [Homo sapiens]
GI:613410183 GenBank ADQ31965.1 184 high density lipoprotein-binding protein, partial [synthetic construct]
GI:613410183 GenBank AIC58140.1 184 GPIHBP1, partial [synthetic construct]

Related Sequences to LMP003729 proteins

Reference Database Accession Length Protein Name
GI:613410183 GenBank EAW82276.1 184 high density lipoprotein-binding protein [Homo sapiens]
GI:613410183 GenBank ACE20661.1 184 Sequence 5892 from patent US 7368531
GI:613410183 GenBank ACE21282.1 184 Sequence 6513 from patent US 7368531
GI:613410183 GenBank ACE52020.1 184 Sequence 30 from patent US 7381800
GI:613410183 GenBank ACH31412.1 184 Sequence 5892 from patent US 7411051
GI:613410183 GenBank ACH32033.1 184 Sequence 6513 from patent US 7411051