Gene/Proteome Database (LMPD)
LMPD ID
LMP003729
Gene ID
Species
Homo sapiens (Human)
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Synonyms
GPI-HBP1; HYPL1D
Alternate Names
glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; endothelial cell LPL transporter; GPI-anchored HDL-binding protein 1; GPI anchored high density lipoprotein binding protein 1
Chromosome
8
Map Location
8q24.3
Summary
This gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]
Orthologs
Proteins
| glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 1 precursor | |
|---|---|
| Refseq ID | NP_835466 |
| Protein GI | 613410183 |
| UniProt ID | Q8IV16 |
| mRNA ID | NM_178172 |
| Length | 184 |
| RefSeq Status | REVIEWED |
| MKALGAVLLALLLFGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTGKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP | |
| sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2054 peptide sequence: MKALGAVLLALLLFGRPGRG sig_peptide: 1..20 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2054 peptide sequence: MKALGAVLLALLLFGRPGRG mat_peptide: 21..151 product: Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8IV16.2) calculated_mol_wt: 14713 peptide sequence: QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPTG | |
Gene Information
Entrez Gene ID
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0031362 | IDA:BHF-UCL | C | anchored component of external side of plasma membrane |
| GO:0016324 | ISS:BHF-UCL | C | apical plasma membrane |
| GO:0016323 | ISS:BHF-UCL | C | basolateral plasma membrane |
| GO:0009897 | IDA:BHF-UCL | C | external side of plasma membrane |
| GO:0034364 | IEA:UniProtKB-KW | C | high-density lipoprotein particle |
| GO:0035478 | IDA:BHF-UCL | F | chylomicron binding |
| GO:0035473 | IPI:BHF-UCL | F | lipase binding |
| GO:0008289 | IEA:UniProtKB-KW | F | lipid binding |
| GO:0071813 | IDA:UniProtKB | F | lipoprotein particle binding |
| GO:0008320 | ISS:BHF-UCL | F | protein transmembrane transporter activity |
| GO:0042632 | ISS:BHF-UCL | P | cholesterol homeostasis |
| GO:0006886 | ISS:BHF-UCL | P | intracellular protein transport |
| GO:0090321 | ISS:BHF-UCL | P | positive regulation of chylomicron remnant clearance |
| GO:0051006 | IMP:BHF-UCL | P | positive regulation of lipoprotein lipase activity |
| GO:0017038 | ISS:BHF-UCL | P | protein import |
| GO:0034394 | ISS:BHF-UCL | P | protein localization to cell surface |
| GO:0050821 | ISS:BHF-UCL | P | protein stabilization |
| GO:0071806 | ISS:GOC | P | protein transmembrane transport |
| GO:0071503 | IMP:BHF-UCL | P | response to heparin |
| GO:0045056 | ISS:BHF-UCL | P | transcytosis |
| GO:0070328 | IMP:BHF-UCL | P | triglyceride homeostasis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1
Protein Entry
HDBP1_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Plays a key role in the lipolytic processing of chylomicrons. Required for the transport of lipoprotein lipase LPL into the capillary lumen (By similarity). |
| Polymorphism | The missense variant Arg-56 may be associated with severe hypertriglyceridemia and chylomicronemia. |
| Ptm | Glycosylation of Asn-78 is critical for cell surface localization and the binding of chylomicrons and lipoprotein lipase. |
| Similarity | Contains 1 UPAR/Ly6 domain. |
| Subcellular Location | Apical cell membrane ; Lipid- anchor, GPI-anchor . Basolateral cell membrane {ECO |
| Subunit | Binds with high affinity to high-density lipoprotein (HDL) (By similarity). Binds to lipoprotein lipase (LPL), chylomicrons and APOA5. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003729 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 613410183 | RefSeq | NP_835466 | 184 | glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1 isoform 1 precursor |
Identical Sequences to LMP003729 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:613410183 | GenBank | AAH63857.1 | 184 | Glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [Homo sapiens] |
| GI:613410183 | GenBank | ADQ31965.1 | 184 | high density lipoprotein-binding protein, partial [synthetic construct] |
| GI:613410183 | GenBank | AIC58140.1 | 184 | GPIHBP1, partial [synthetic construct] |
Related Sequences to LMP003729 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:613410183 | GenBank | EAW82276.1 | 184 | high density lipoprotein-binding protein [Homo sapiens] |
| GI:613410183 | GenBank | ACE20661.1 | 184 | Sequence 5892 from patent US 7368531 |
| GI:613410183 | GenBank | ACE21282.1 | 184 | Sequence 6513 from patent US 7368531 |
| GI:613410183 | GenBank | ACE52020.1 | 184 | Sequence 30 from patent US 7381800 |
| GI:613410183 | GenBank | ACH31412.1 | 184 | Sequence 5892 from patent US 7411051 |
| GI:613410183 | GenBank | ACH32033.1 | 184 | Sequence 6513 from patent US 7411051 |