Gene/Proteome Database (LMPD)
LMPD ID
LMP003796
Gene ID
Species
Homo sapiens (Human)
Gene Name
G protein-coupled bile acid receptor 1
Gene Symbol
Synonyms
BG37; GPCR19; GPR131; M-BAR; TGR5
Alternate Names
G-protein coupled bile acid receptor 1; hBG37; hGPCR19; membrane bile acid receptor; G-protein coupled receptor GPCR19; membrane-type receptor for bile acids; G-protein coupled bile acid receptor BG37
Chromosome
2
Map Location
2q35
Summary
This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| G-protein coupled bile acid receptor 1 | |
|---|---|
| Refseq ID | NP_001070662 |
| Protein GI | 116284382 |
| UniProt ID | Q8TDU6 |
| mRNA ID | NM_001077194 |
| Length | 330 |
| RefSeq Status | REVIEWED |
| MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN | |
| G-protein coupled bile acid receptor 1 | |
|---|---|
| Refseq ID | NP_001070659 |
| Protein GI | 116284384 |
| UniProt ID | Q8TDU6 |
| mRNA ID | NM_001077191 |
| Length | 330 |
| RefSeq Status | REVIEWED |
| Protein sequence is identical to GI:116284382 (mRNA isoform) | |
Gene Information
Entrez Gene ID
Gene Name
G protein-coupled bile acid receptor 1
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IDA:UniProtKB | C | plasma membrane |
| GO:0038182 | NAS:UniProtKB | F | G-protein coupled bile acid receptor activity |
| GO:0038181 | IDA:UniProtKB | F | bile acid receptor activity |
| GO:0038184 | IC:UniProtKB | P | cell surface bile acid receptor signaling pathway |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_14828 | Class A/1 (Rhodopsin-like receptors) |
| REACT_19327 | G alpha (s) signalling events |
| REACT_19184 | GPCR downstream signaling |
| REACT_21340 | GPCR ligand binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
G protein-coupled bile acid receptor 1
Protein Entry
GPBAR_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Function | Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. |
| Similarity | Belongs to the G-protein coupled receptor 1 family. |
| Subcellular Location | Cell membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Ubiquitously expressed. Expressed at higher level in spleen and placenta. Expressed at lower level in other tissues. In digestive tissues, it is expressed in stomach, duodenum, ileocecum, ileum, jejunum, ascending colon, transverse colon, descending colon, cecum and liver, but not in esophagus and rectum. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP003796 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 116284382 | RefSeq | NP_001070662 | 330 | G-protein coupled bile acid receptor 1 |
Identical Sequences to LMP003796 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116284382 | GenBank | ACK08361.1 | 330 | Sequence 2 from patent US 7432361 |
| GI:116284382 | GenBank | ACS06257.1 | 330 | Sequence 2 from patent US 7534783 |
| GI:116284382 | GenBank | ADA49960.1 | 330 | Sequence 2 from patent US 7625887 |
| GI:116284382 | GenBank | ADL99260.1 | 330 | Sequence 2 from patent US 7723046 |
| GI:116284382 | GenBank | AEW42491.1 | 330 | Sequence 2 from patent US 8076455 |
| GI:116284382 | GenBank | AIC53235.1 | 330 | GPBAR1, partial [synthetic construct] |
Related Sequences to LMP003796 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:116284382 | DBBJ | BAK62323.1 | 330 | G-protein coupled bile acid receptor 1 [Pan troglodytes] |
| GI:116284382 | RefSeq | XP_003818657.1 | 330 | PREDICTED: G-protein coupled bile acid receptor 1 [Pan paniscus] |
| GI:116284382 | RefSeq | XP_004033248.1 | 330 | PREDICTED: G-protein coupled bile acid receptor 1 isoform 1 [Gorilla gorilla gorilla] |
| GI:116284382 | RefSeq | XP_004033249.1 | 330 | PREDICTED: G-protein coupled bile acid receptor 1 isoform 2 [Gorilla gorilla gorilla] |
| GI:116284382 | RefSeq | XP_004033250.1 | 330 | PREDICTED: G-protein coupled bile acid receptor 1 isoform 3 [Gorilla gorilla gorilla] |
| GI:116284382 | RefSeq | XP_004033251.1 | 330 | PREDICTED: G-protein coupled bile acid receptor 1 isoform 4 [Gorilla gorilla gorilla] |