Gene/Proteome Database (LMPD)
Proteins
methylmalonyl-CoA epimerase, mitochondrial precursor | |
---|---|
Refseq ID | NP_082902 |
Protein GI | 58037329 |
UniProt ID | Q9D1I5 |
mRNA ID | NM_028626 |
Length | 178 |
RefSeq Status | PROVISIONAL |
MRRVVKAAALAAGATGLFSRVQTSVAIGRSFSTPQSQFQESSPVWKLGRLNHVAVAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPITGFLQKNKAGGMHHVCIEVDNISAAVMDLKKKKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVELEQA | |
transit_peptide: 1..38 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q9D1I5.1) calculated_mol_wt: 3969 peptide sequence: MRRVVKAAALAAGATGLFSRVQTSVAIGRSFSTPQSQF mat_peptide: 39..178 product: Methylmalonyl-CoA epimerase, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9D1I5.1) calculated_mol_wt: 15067 peptide sequence: QESSPVWKLGRLNHVAVAVPDLEKASSFYRDVLGAQVSEVVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPITGFLQKNKAGGMHHVCIEVDNISAAVMDLKKKKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVELEQA |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0004493 | IEA:UniProtKB-EC | F | methylmalonyl-CoA epimerase activity |
GO:0046491 | IEA:Ensembl | P | L-methylmalonyl-CoA metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
mmu01200 | Carbon metabolism |
mmu00630 | Glyoxylate and dicarboxylate metabolism |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY3DJ-0 | isoleucine degradation |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5892796 | Propionyl-CoA catabolism |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | (R)-methylmalonyl-CoA = (S)-methylmalonyl-CoA. |
Similarity | Belongs to the glyoxalase I family. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003823 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
58037329 | RefSeq | NP_082902 | 178 | methylmalonyl-CoA epimerase, mitochondrial precursor |
Identical Sequences to LMP003823 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58037329 | DBBJ | BAB22828.1 | 178 | unnamed protein product [Mus musculus] |
GI:58037329 | GenBank | AAH38157.1 | 178 | Methylmalonyl CoA epimerase [Mus musculus] |
GI:58037329 | GenBank | EDL07253.1 | 178 | methylmalonyl CoA epimerase, isoform CRA_a [Mus musculus] |
GI:58037329 | SwissProt | Q9D1I5.1 | 178 | RecName: Full=Methylmalonyl-CoA epimerase, mitochondrial; AltName: Full=DL-methylmalonyl-CoA racemase; Flags: Precursor [Mus musculus] |
Related Sequences to LMP003823 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:58037329 | GenBank | EDM08394.1 | 178 | methylmalonyl CoA epimerase (predicted), isoform CRA_d [Rattus norvegicus] |
GI:58037329 | GenBank | EGW00330.1 | 178 | Methylmalonyl-CoA epimerase, mitochondrial [Cricetulus griseus] |
GI:58037329 | GenBank | ERE78250.1 | 178 | methylmalonyl-CoA epimerase [Cricetulus griseus] |
GI:58037329 | RefSeq | NP_001099811.1 | 178 | methylmalonyl-CoA epimerase, mitochondrial [Rattus norvegicus] |
GI:58037329 | RefSeq | XP_005084465.1 | 178 | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Mesocricetus auratus] |
GI:58037329 | RefSeq | XP_005357861.1 | 178 | PREDICTED: methylmalonyl-CoA epimerase, mitochondrial [Microtus ochrogaster] |