Gene/Proteome Database (LMPD)
LMPD ID
LMP003825
Gene ID
Species
Homo sapiens (Human)
Gene Name
monoacylglycerol O-acyltransferase 2
Gene Symbol
Synonyms
DGAT2L5; MGAT2
Alternate Names
2-acylglycerol O-acyltransferase 2; hDC5; hMGAT2; acyl CoA:monoacylglycerol acyltransferase 2; acyl-CoA:monoacylglycerol acyltransferase 2; diacylglycerol O-acyltransferase candidate 5; diacylglycerol acyltransferase 2-like protein 5
Chromosome
11
Map Location
11q13.5
EC Number
2.3.1.22
Summary
Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
| 2-acylglycerol O-acyltransferase 2 | |
|---|---|
| Refseq ID | NP_079374 |
| Protein GI | 37537527 |
| UniProt ID | Q3SYC2 |
| mRNA ID | NM_025098 |
| Length | 334 |
| RefSeq Status | PROVISIONAL |
| MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC | |
Gene Information
Entrez Gene ID
Gene Name
monoacylglycerol O-acyltransferase 2
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:MGI | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003846 | IEA:UniProtKB-EC | F | 2-acylglycerol O-acyltransferase activity |
| GO:0016407 | IEA:Ensembl | F | acetyltransferase activity |
| GO:0006651 | IEA:Ensembl | P | diacylglycerol biosynthetic process |
| GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
| GO:0050892 | IEA:Ensembl | P | intestinal absorption |
| GO:0019432 | IEA:UniProtKB-UniPathway | P | triglyceride biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007130 | Diacylglycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
monoacylglycerol O-acyltransferase 2
Protein Entry
MOGT2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q3SYC2-1; Sequence=Displayed; Name=2; IsoId=Q3SYC2-2; Sequence=VSP_020358; Note=No experimental confirmation available.; Name=3; Synonyms=MGAT2V, Trunc; IsoId=Q3SYC2-3; Sequence=VSP_020359, VSP_020360; |
| Biophysicochemical Properties | Kinetic parameters: KM=45 uM for sn-1-monooleoylglycerol ; |
| Catalytic Activity | Acyl-CoA + 2-acylglycerol = CoA + diacylglycerol. |
| Enzyme Regulation | Inhibited by oleic acid and sphingosine, while it is stimulated by phosphatidylcholine, phosphatidylserine and phosphatidic acid. |
| Function | Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Has a preference toward monoacylglycerols containing unsaturated fatty acids in an order of C18:3 > C18:2 > C18:1 > C18:0. Plays a central role in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. May play a role in diet-induced obesity. |
| Pathway | Glycerolipid metabolism; triacylglycerol biosynthesis. |
| Similarity | Belongs to the diacylglycerol acyltransferase family. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Highly expressed in liver, small intestine, colon, stomach and kidney. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP003825 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 37537527 | RefSeq | NP_079374 | 334 | 2-acylglycerol O-acyltransferase 2 |
Identical Sequences to LMP003825 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:37537527 | GenBank | AFQ73191.1 | 334 | Sequence 2 from patent US 8232447 |
| GI:37537527 | GenBank | AGC98162.1 | 334 | Sequence 2 from patent US 8334111 |
| GI:37537527 | GenBank | AGX59580.1 | 334 | Sequence 19439 from patent US 8541208 |
| GI:37537527 | GenBank | AGX72245.1 | 334 | Sequence 44289 from patent US 8541208 |
| GI:37537527 | GenBank | AHD78079.1 | 334 | Sequence 25058 from patent US 8586006 |
| GI:37537527 | GenBank | AIC52367.1 | 334 | MOGAT2, partial [synthetic construct] |
Related Sequences to LMP003825 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:37537527 | GenBank | AAI03878.1 | 334 | Monoacylglycerol O-acyltransferase 2 [Homo sapiens] |
| GI:37537527 | GenBank | EHH23258.1 | 334 | hypothetical protein EGK_06693 [Macaca mulatta] |
| GI:37537527 | GenBank | EHH56594.1 | 334 | hypothetical protein EGM_06042 [Macaca fascicularis] |
| GI:37537527 | RefSeq | XP_003910482.1 | 334 | PREDICTED: 2-acylglycerol O-acyltransferase 2 [Papio anubis] |
| GI:37537527 | RefSeq | XP_005579169.1 | 334 | PREDICTED: 2-acylglycerol O-acyltransferase 2 isoform X1 [Macaca fascicularis] |
| GI:37537527 | RefSeq | XP_008018375.1 | 334 | PREDICTED: 2-acylglycerol O-acyltransferase 2 [Chlorocebus sabaeus] |