Gene/Proteome Database (LMPD)

LMPD ID
LMP003856
Gene ID
79644
Species
Homo sapiens (Human)
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
SRD5A3
Synonyms
CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1
Alternate Names
polyprenol reductase; S5AR 3; SR type 3; probable polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3
Chromosome
4
Map Location
4q12
EC Number
1.3.1.94
Summary
The protein encoded by this gene belongs to the steroid 5-alpha reductase family, and polyprenol reductase subfamily. It is involved in the production of androgen 5-alpha-dihydrotestosterone (DHT) from testosterone, and maintenance of the androgen-androgen receptor activation pathway. This protein is also necessary for the conversion of polyprenol into dolichol, which is required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-linked glycosylation of proteins. Mutations in this gene are associated with congenital disorder of glycosylation type Iq. [provided by RefSeq, Mar 2011]
Orthologs
View orthologs and multiple alignments for SRD5A3

Proteins

polyprenol reductase
Refseq ID NP_078868
Protein GI 13375785
UniProt ID Q9H8P0
mRNA ID NM_024592
Length 318
RefSeq Status REVIEWED
MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF

Gene Information

Entrez Gene ID
79644
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
SRD5A3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003865 IDA:UniProtKB F 3-oxo-5-alpha-steroid 4-dehydrogenase activity
GO:0047751 IEA:UniProtKB-EC F cholestenone 5-alpha-reductase activity
GO:0016628 IDA:UniProtKB F oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0006702 TAS:Reactome P androgen biosynthetic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0019348 IDA:UniProtKB P dolichol metabolic process
GO:0006488 IMP:UniProtKB P dolichol-linked oligosaccharide biosynthetic process
GO:0006489 TAS:Reactome P dolichyl diphosphate biosynthetic process
GO:0016095 IDA:UniProtKB P polyprenol catabolic process
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0018279 TAS:Reactome P protein N-linked glycosylation via asparagine
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0008202 TAS:Reactome P steroid metabolic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00140 Steroid hormone biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_11059 Androgen biosynthesis
REACT_22230 Synthesis of Dolichyl-phosphate
REACT_22387 Synthesis of substrates in N-glycan biosythesis

Domain Information

InterPro Annotations

Accession Description
IPR001104 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal

UniProt Annotations

Entry Information

Gene Name
steroid 5 alpha-reductase 3
Protein Entry
PORED_HUMAN
UniProt ID
Q9H8P0
Species
Human

Comments

Comment Type Description
Catalytic Activity A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH.
Catalytic Activity Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH.
Disease Congenital disorder of glycosylation 1Q (CDG1Q) [MIM
Disease Kahrizi syndrome (KHRZ) [MIM
Function Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT).
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Overexpressed in hormone-refractory prostate cancers (HRPC). Almost no or little expression in normal adult organs.

Identical and Related Proteins

Unique RefSeq proteins for LMP003856 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13375785 RefSeq NP_078868 318 polyprenol reductase

Identical Sequences to LMP003856 proteins

Reference Database Accession Length Protein Name
GI:13375785 GenBank JAA11571.1 318 steroid 5 alpha-reductase 3 [Pan troglodytes]
GI:13375785 GenBank JAA23710.1 318 steroid 5 alpha-reductase 3 [Pan troglodytes]
GI:13375785 GenBank JAA33314.1 318 steroid 5 alpha-reductase 3 [Pan troglodytes]
GI:13375785 GenBank AHD78673.1 318 Sequence 26671 from patent US 8586006
GI:13375785 GenBank AIC52283.1 318 SRD5A3, partial [synthetic construct]
GI:13375785 RefSeq XP_008952469.1 318 PREDICTED: polyprenol reductase [Pan paniscus]

Related Sequences to LMP003856 proteins

Reference Database Accession Length Protein Name
GI:13375785 GenBank AFE66544.1 318 putative polyprenol reductase [Macaca mulatta]
GI:13375785 RefSeq XP_002814830.1 318 PREDICTED: polyprenol reductase isoform X1 [Pongo abelii]
GI:13375785 RefSeq NP_001244878.1 318 probable polyprenol reductase [Macaca mulatta]
GI:13375785 RefSeq XP_003898926.1 318 PREDICTED: polyprenol reductase [Papio anubis]
GI:13375785 RefSeq XP_004038736.1 318 PREDICTED: probable polyprenol reductase [Gorilla gorilla gorilla]
GI:13375785 RefSeq XP_007996877.1 318 PREDICTED: polyprenol reductase [Chlorocebus sabaeus]