Gene/Proteome Database (LMPD)
LMPD ID
LMP003856
Gene ID
Species
Homo sapiens (Human)
Gene Name
steroid 5 alpha-reductase 3
Gene Symbol
Synonyms
CDG1P; CDG1Q; KRIZI; SRD5A2L; SRD5A2L1
Alternate Names
polyprenol reductase; S5AR 3; SR type 3; probable polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3
Chromosome
4
Map Location
4q12
EC Number
1.3.1.94
Summary
The protein encoded by this gene belongs to the steroid 5-alpha reductase family, and polyprenol reductase subfamily. It is involved in the production of androgen 5-alpha-dihydrotestosterone (DHT) from testosterone, and maintenance of the androgen-androgen receptor activation pathway. This protein is also necessary for the conversion of polyprenol into dolichol, which is required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-linked glycosylation of proteins. Mutations in this gene are associated with congenital disorder of glycosylation type Iq. [provided by RefSeq, Mar 2011]
Orthologs
Proteins
| polyprenol reductase | |
|---|---|
| Refseq ID | NP_078868 |
| Protein GI | 13375785 |
| UniProt ID | Q9H8P0 |
| mRNA ID | NM_024592 |
| Length | 318 |
| RefSeq Status | REVIEWED |
| MAPWAEAEHSALNPLRAVWLTLTAAFLLTLLLQLLPPGLLPGCAIFQDLIRYGKTKCGEPSRPAACRAFDVPKRYFSHFYIISVLWNGFLLWCLTQSLFLGAPFPSWLHGLLRILGAAQFQGGELALSAFLVLVFLWLHSLRRLFECLYVSVFSNVMIHVVQYCFGLVYYVLVGLTVLSQVPMDGRNAYITGKNLLMQARWFHILGMMMFIWSSAHQYKCHVILGNLRKNKAGVVIHCNHRIPFGDWFEYVSSPNYLAELMIYVSMAVTFGFHNLTWWLVVTNVFFNQALSAFLSHQFYKSKFVSYPKHRKAFLPFLF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
| GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | IDA:UniProtKB | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0047751 | IEA:UniProtKB-EC | F | cholestenone 5-alpha-reductase activity |
| GO:0016628 | IDA:UniProtKB | F | oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor |
| GO:0006702 | TAS:Reactome | P | androgen biosynthetic process |
| GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
| GO:0019348 | IDA:UniProtKB | P | dolichol metabolic process |
| GO:0006488 | IMP:UniProtKB | P | dolichol-linked oligosaccharide biosynthetic process |
| GO:0006489 | TAS:Reactome | P | dolichyl diphosphate biosynthetic process |
| GO:0016095 | IDA:UniProtKB | P | polyprenol catabolic process |
| GO:0043687 | TAS:Reactome | P | post-translational protein modification |
| GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
| GO:0008202 | TAS:Reactome | P | steroid metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa00140 | Steroid hormone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_11059 | Androgen biosynthesis |
| REACT_22230 | Synthesis of Dolichyl-phosphate |
| REACT_22387 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 3-oxo-5-alpha-steroid + NADP(+) = a 3-oxo- Delta(4)-steroid + NADPH. |
| Catalytic Activity | Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH. |
| Disease | Congenital disorder of glycosylation 1Q (CDG1Q) [MIM |
| Disease | Kahrizi syndrome (KHRZ) [MIM |
| Function | Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. Also able to convert testosterone (T) into 5-alpha-dihydrotestosterone (DHT). |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily. |
| Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
| Tissue Specificity | Overexpressed in hormone-refractory prostate cancers (HRPC). Almost no or little expression in normal adult organs. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003856 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 13375785 | RefSeq | NP_078868 | 318 | polyprenol reductase |
Identical Sequences to LMP003856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13375785 | GenBank | JAA11571.1 | 318 | steroid 5 alpha-reductase 3 [Pan troglodytes] |
| GI:13375785 | GenBank | JAA23710.1 | 318 | steroid 5 alpha-reductase 3 [Pan troglodytes] |
| GI:13375785 | GenBank | JAA33314.1 | 318 | steroid 5 alpha-reductase 3 [Pan troglodytes] |
| GI:13375785 | GenBank | AHD78673.1 | 318 | Sequence 26671 from patent US 8586006 |
| GI:13375785 | GenBank | AIC52283.1 | 318 | SRD5A3, partial [synthetic construct] |
| GI:13375785 | RefSeq | XP_008952469.1 | 318 | PREDICTED: polyprenol reductase [Pan paniscus] |
Related Sequences to LMP003856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:13375785 | GenBank | AFE66544.1 | 318 | putative polyprenol reductase [Macaca mulatta] |
| GI:13375785 | RefSeq | XP_002814830.1 | 318 | PREDICTED: polyprenol reductase isoform X1 [Pongo abelii] |
| GI:13375785 | RefSeq | NP_001244878.1 | 318 | probable polyprenol reductase [Macaca mulatta] |
| GI:13375785 | RefSeq | XP_003898926.1 | 318 | PREDICTED: polyprenol reductase [Papio anubis] |
| GI:13375785 | RefSeq | XP_004038736.1 | 318 | PREDICTED: probable polyprenol reductase [Gorilla gorilla gorilla] |
| GI:13375785 | RefSeq | XP_007996877.1 | 318 | PREDICTED: polyprenol reductase [Chlorocebus sabaeus] |