Gene/Proteome Database (LMPD)

LMPD ID
LMP003883
Gene ID
Species
Mus musculus (Mouse)
Gene Name
coenzyme Q9 homolog (yeast)
Gene Symbol
Synonyms
2310005O14Rik; C78387
Alternate Names
ubiquinone biosynthesis protein COQ9, mitochondrial
Chromosome
8
Map Location
8 C5-D1|8

Proteins

ubiquinone biosynthesis protein COQ9, mitochondrial precursor
Refseq ID NP_080728
Protein GI 33859690
UniProt ID Q8K1Z0
mRNA ID NM_026452
Length 313
RefSeq Status PROVISIONAL
MAATAAVSGVLGRLGWRLLQLRCLPVARCRPALVPRAFHTAVGFRSSEEQKQQPPHSSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNQVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPHNIPPSLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR
transit_peptide: 1..45 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q8K1Z0.1) calculated_mol_wt: 4860 peptide sequence: MAATAAVSGVLGRLGWRLLQLRCLPVARCRPALVPRAFHTAVGFR mat_peptide: 46..313 product: Ubiquinone biosynthesis protein COQ9, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8K1Z0.1) calculated_mol_wt: 30241 peptide sequence: SSEEQKQQPPHSSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNQVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPHNIPPSLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q9 homolog (yeast)
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IDA:MGI C mitochondrion
GO:0006120 IMP:MGI P mitochondrial electron transport, NADH to ubiquinone
GO:0006744 IMP:MGI P ubiquinone biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR013718 COQ9
IPR012762 Ubiquinone biosynthesis protein COQ9

UniProt Annotations

Entry Information

Gene Name
coenzyme Q9 homolog (yeast)
Protein Entry
COQ9_MOUSE
UniProt ID
Species
Mouse

Comments

Comment Type Description
Function Involved in the biosynthesis of coenzyme Q. {ECO:0000250}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the COQ9 family. {ECO:0000305}.
Subcellular Location Mitochondrion.

Identical and Related Proteins

Unique RefSeq proteins for LMP003883 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
33859690 RefSeq NP_080728 313 ubiquinone biosynthesis protein COQ9, mitochondrial precursor

Identical Sequences to LMP003883 proteins

Reference Database Accession Length Protein Name
GI:33859690 DBBJ BAE32528.1 313 unnamed protein product [Mus musculus]
GI:33859690 DBBJ BAE34754.1 313 unnamed protein product [Mus musculus]
GI:33859690 GenBank AAH36386.1 313 Coenzyme Q9 homolog (yeast) [Mus musculus]
GI:33859690 GenBank AEH97512.1 313 Sequence 107 from patent US 7947436
GI:33859690 GenBank AGN07856.1 313 Sequence 107 from patent US 8444975
GI:33859690 SwissProt Q8K1Z0.1 313 RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Mus musculus]

Related Sequences to LMP003883 proteins

Reference Database Accession Length Protein Name
GI:33859690 GenBank AAH79370.1 310 Coq9 protein, partial [Rattus norvegicus]
GI:33859690 GenBank AAI04703.1 310 Coq9 protein, partial [Rattus norvegicus]
GI:33859690 GenBank AAI27450.1 312 Coenzyme Q9 homolog (S. cerevisiae) [Rattus norvegicus]
GI:33859690 RefSeq NP_001030334.1 312 ubiquinone biosynthesis protein COQ9, mitochondrial precursor [Rattus norvegicus]
GI:33859690 RefSeq XP_005078677.1 317 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Mesocricetus auratus]
GI:33859690 SwissProt Q68FT1.2 312 RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Rattus norvegicus]