Gene/Proteome Database (LMPD)
Proteins
ubiquinone biosynthesis protein COQ9, mitochondrial precursor | |
---|---|
Refseq ID | NP_080728 |
Protein GI | 33859690 |
UniProt ID | Q8K1Z0 |
mRNA ID | NM_026452 |
Length | 313 |
RefSeq Status | PROVISIONAL |
MAATAAVSGVLGRLGWRLLQLRCLPVARCRPALVPRAFHTAVGFRSSEEQKQQPPHSSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNQVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPHNIPPSLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR | |
transit_peptide: 1..45 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (Q8K1Z0.1) calculated_mol_wt: 4860 peptide sequence: MAATAAVSGVLGRLGWRLLQLRCLPVARCRPALVPRAFHTAVGFR mat_peptide: 46..313 product: Ubiquinone biosynthesis protein COQ9, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q8K1Z0.1) calculated_mol_wt: 30241 peptide sequence: SSEEQKQQPPHSSSQQHSETQGPEFSRPPPRYTDQSGEEEEDYESEEQLQHRILTAALEFVPAHGWTAEAIAEGAQSLGLSSAAASMFGSDGSELILHFVTQCNARLNQVLEEEQKLVQLGQAEKRKTDQFLRDAVETRLRMLIPYIEHWPRALSILLLPHNIPPSLNLLTSMVDDMWHYAGDQSTDFNWYTRRAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0006120 | IMP:MGI | P | mitochondrial electron transport, NADH to ubiquinone |
GO:0006744 | IMP:MGI | P | ubiquinone biosynthetic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Involved in the biosynthesis of coenzyme Q. {ECO:0000250}. |
Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
Similarity | Belongs to the COQ9 family. {ECO:0000305}. |
Subcellular Location | Mitochondrion. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003883 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
33859690 | RefSeq | NP_080728 | 313 | ubiquinone biosynthesis protein COQ9, mitochondrial precursor |
Identical Sequences to LMP003883 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:33859690 | DBBJ | BAE32528.1 | 313 | unnamed protein product [Mus musculus] |
GI:33859690 | DBBJ | BAE34754.1 | 313 | unnamed protein product [Mus musculus] |
GI:33859690 | GenBank | AAH36386.1 | 313 | Coenzyme Q9 homolog (yeast) [Mus musculus] |
GI:33859690 | GenBank | AEH97512.1 | 313 | Sequence 107 from patent US 7947436 |
GI:33859690 | GenBank | AGN07856.1 | 313 | Sequence 107 from patent US 8444975 |
GI:33859690 | SwissProt | Q8K1Z0.1 | 313 | RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Mus musculus] |
Related Sequences to LMP003883 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:33859690 | GenBank | AAH79370.1 | 310 | Coq9 protein, partial [Rattus norvegicus] |
GI:33859690 | GenBank | AAI04703.1 | 310 | Coq9 protein, partial [Rattus norvegicus] |
GI:33859690 | GenBank | AAI27450.1 | 312 | Coenzyme Q9 homolog (S. cerevisiae) [Rattus norvegicus] |
GI:33859690 | RefSeq | NP_001030334.1 | 312 | ubiquinone biosynthesis protein COQ9, mitochondrial precursor [Rattus norvegicus] |
GI:33859690 | RefSeq | XP_005078677.1 | 317 | PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Mesocricetus auratus] |
GI:33859690 | SwissProt | Q68FT1.2 | 312 | RecName: Full=Ubiquinone biosynthesis protein COQ9, mitochondrial; Flags: Precursor [Rattus norvegicus] |