Gene/Proteome Database (LMPD)
LMPD ID
LMP003948
Gene ID
Species
Homo sapiens (Human)
Gene Name
crystallin, zeta (quinone reductase)
Gene Symbol
Synonyms
-
Alternate Names
quinone oxidoreductase; NADPH:quinone reductase
Chromosome
1
Map Location
1p31.1
EC Number
1.6.5.5
Summary
Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. The former class is also called phylogenetically-restricted crystallins. This gene encodes a taxon-specific crystallin protein which has NADPH-dependent quinone reductase activity distinct from other known quinone reductases. It lacks alcohol dehydrogenase activity although by similarity it is considered a member of the zinc-containing alcohol dehydrogenase family. Unlike other mammalian species, in humans, lens expression is low. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One pseudogene is known to exist. [provided by RefSeq, Sep 2008]
Orthologs
Proteins
quinone oxidoreductase isoform a | |
---|---|
Refseq ID | NP_001880 |
Protein GI | 13236495 |
UniProt ID | Q08257 |
mRNA ID | NM_001889 |
Length | 329 |
RefSeq Status | REVIEWED |
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEKLDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL |
quinone oxidoreductase isoform a | |
---|---|
Refseq ID | NP_001123514 |
Protein GI | 194239674 |
UniProt ID | Q08257 |
mRNA ID | NM_001130042 |
Length | 329 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:13236495 (mRNA isoform) |
quinone oxidoreductase isoform b | |
---|---|
Refseq ID | NP_001123515 |
Protein GI | 194239674 |
UniProt ID | Q08257 |
mRNA ID | NM_001130043 |
Length | 329 |
RefSeq Status | REVIEWED |
Protein sequence is identical to GI:13236495 (mRNA isoform) |
quinone oxidoreductase isoform c | |
---|---|
Refseq ID | NP_001128231 |
Protein GI | 197927207 |
UniProt ID | Q08257 |
mRNA ID | NM_001134759 |
Length | 192 |
RefSeq Status | REVIEWED |
MHLLSSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTAGTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIGSQYPLEKVAEAHENIIHGSGATGKMILLL |
Gene Information
Entrez Gene ID
Gene Name
crystallin, zeta (quinone reductase)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005794 | IDA:HPA | C | Golgi apparatus |
GO:0005737 | IDA:HPA | C | cytoplasm |
GO:0005829 | IDA:UniProtKB | C | cytosol |
GO:0070062 | IDA:UniProtKB | C | extracellular vesicular exosome |
GO:0043231 | IDA:HPA | C | intracellular membrane-bounded organelle |
GO:0070402 | IDA:UniProtKB | F | NADPH binding |
GO:0003960 | IDA:UniProtKB | F | NADPH:quinone reductase activity |
GO:0003730 | IDA:UniProtKB | F | mRNA 3'-UTR binding |
GO:0008270 | IEA:InterPro | F | zinc ion binding |
GO:0051289 | IPI:UniProtKB | P | protein homotetramerization |
GO:0007601 | TAS:ProtInc | P | visual perception |
GO:0042178 | IDA:UniProtKB | P | xenobiotic catabolic process |
Domain Information
InterPro Annotations
UniProt Annotations
Entry Information
Gene Name
crystallin, zeta (quinone reductase)
Protein Entry
QOR_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q08257-1; Sequence=Displayed; Name=2; IsoId=Q08257-2; Sequence=VSP_042927, VSP_042928; Note=No experimental confirmation available.; Name=3; IsoId=Q08257-3; Sequence=VSP_046425; Note=No experimental confirmation available.; |
Catalytic Activity | NADPH + 2 quinone = NADP(+) + 2 semiquinone. |
Function | Does not have alcohol dehydrogenase activity. Binds NADP and acts through a one-electron transfer process. Orthoquinones, such as 1,2-naphthoquinone or 9,10-phenanthrenequinone, are the best substrates (in vitro). May act in the detoxification of xenobiotics. Interacts with (AU)-rich elements (ARE) in the 3'-UTR of target mRNA species. Enhances the stability of mRNA coding for BCL2. NADPH binding interferes with mRNA binding. |
Similarity | Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily. |
Subcellular Location | Cytoplasm . |
Subunit | Homotetramer. {ECO |
Tissue Specificity | Only very low amounts in the lens. |
Identical and Related Proteins
Unique RefSeq proteins for LMP003948 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13236495 | RefSeq | NP_001880 | 329 | quinone oxidoreductase isoform a |
197927207 | RefSeq | NP_001128231 | 192 | quinone oxidoreductase isoform c |
Identical Sequences to LMP003948 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:197927207 | EMBL | CAI46072.1 | 192 | hypothetical protein [Homo sapiens] |
GI:197927207 | GenBank | EAX06409.1 | 192 | crystallin, zeta (quinone reductase), isoform CRA_a [Homo sapiens] |
GI:197927207 | GenBank | ADA20373.1 | 192 | Sequence 2197 from patent US 7608413 |
GI:13236495 | GenBank | AEN36265.1 | 329 | Sequence 2193 from patent US 7998689 |
GI:13236495 | GenBank | AEN36266.1 | 329 | Sequence 2194 from patent US 7998689 |
GI:13236495 | GenBank | AEN36267.1 | 329 | Sequence 2195 from patent US 7998689 |
GI:13236495 | GenBank | AEN36268.1 | 329 | Sequence 2196 from patent US 7998689 |
GI:197927207 | GenBank | AEN36269.1 | 192 | Sequence 2197 from patent US 7998689 |
GI:13236495 | GenBank | AEW41276.1 | 329 | Sequence 23 from patent US 8076089 |
GI:13236495 | GenBank | AHD78367.1 | 329 | Sequence 26365 from patent US 8586006 |
GI:197927207 | RefSeq | XP_005270548.1 | 192 | PREDICTED: quinone oxidoreductase isoform X1 [Homo sapiens] |
Related Sequences to LMP003948 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13236495 | DBBJ | BAD92951.1 | 331 | crystallin, zeta variant, partial [Homo sapiens] |
GI:13236495 | DBBJ | BAD96870.1 | 329 | crystallin, zeta variant, partial [Homo sapiens] |
GI:13236495 | DBBJ | BAD96921.1 | 329 | crystallin, zeta variant, partial [Homo sapiens] |
GI:13236495 | DBBJ | BAI47298.1 | 329 | crystallin, zeta, partial [synthetic construct] |
GI:197927207 | GenBank | ACR86126.1 | 329 | Sequence 685 from patent US 7521195 |
GI:197927207 | GenBank | ACR86128.1 | 329 | Sequence 687 from patent US 7521195 |
GI:197927207 | GenBank | ACR86129.1 | 329 | Sequence 688 from patent US 7521195 |
GI:197927207 | GenBank | AHD78367.1 | 329 | Sequence 26365 from patent US 8586006 |
GI:13236495 | PDB | 1YB5 | 351 | Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp |
GI:13236495 | PDB | 1YB5 | 351 | Chain B, Crystal Structure Of Human Zeta-crystallin With Bound Nadp |
GI:197927207 | RefSeq | XP_009421814.1 | 192 | PREDICTED: quinone oxidoreductase isoform X2 [Pan troglodytes] |
GI:197927207 | SwissProt | Q08257.1 | 329 | RecName: Full=Quinone oxidoreductase; AltName: Full=NADPH:quinone reductase; AltName: Full=Zeta-crystallin [Homo sapiens] |