Gene/Proteome Database (LMPD)
LMPD ID
LMP004011
Gene ID
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 2 (gastrointestinal)
Gene Symbol
Synonyms
GI-GPx; GPRP; GPRP-2; GPx-2; GPx-GI; GSHPX-GI; GSHPx-2
Alternate Names
glutathione peroxidase 2; gastrointestinal glutathione peroxidase; glutathione peroxidase-related protein 2
Chromosome
14
Map Location
14q24.1
EC Number
1.11.1.9
Summary
This gene is a member of the glutathione peroxidase family and encodes a selenium-dependent glutathione peroxidase that is one of two isoenzymes responsible for the majority of the glutathione-dependent hydrogen peroxide-reducing activity in the epithelium of the gastrointestinal tract. The protein encoded by this locus contains a selenocysteine (Sec) residue encoded by the UGA codon, which normally signals translation termination. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]
Orthologs
Proteins
| glutathione peroxidase 2 | |
|---|---|
| Refseq ID | NP_002074 |
| Protein GI | 32967607 |
| UniProt ID | P18283 |
| mRNA ID | NM_002083 |
| Length | 190 |
| RefSeq Status | REVIEWED |
| MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASLUGTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKLIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI | |
Gene Information
Entrez Gene ID
Gene Name
glutathione peroxidase 2 (gastrointestinal)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | TAS:ProtInc | C | cytoplasm |
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0009055 | TAS:UniProtKB | F | electron carrier activity |
| GO:0004602 | TAS:Reactome | F | glutathione peroxidase activity |
| GO:0051702 | IEA:Ensembl | P | interaction with symbiont |
| GO:0002862 | IEA:Ensembl | P | negative regulation of inflammatory response to antigenic stimulus |
| GO:0006979 | IEA:InterPro | P | response to oxidative stress |
| GO:0009609 | IEA:Ensembl | P | response to symbiotic bacterium |
| GO:0001659 | IEA:Ensembl | P | temperature homeostasis |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04918 | Thyroid hormone synthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_172715 | Detoxification of Reactive Oxygen Species |
| REACT_150201 | Synthesis of 12-eicosatetraenoic acid derivatives |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 2 (gastrointestinal)
Protein Entry
GPX2_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
| Function | Could play a major role in protecting mammals from the toxicity of ingested organic hydroperoxides. Tert-butyl hydroperoxide, cumene hydroperoxide and linoleic acid hydroperoxide but not phosphatidycholine hydroperoxide, can act as acceptors. |
| Similarity | Belongs to the glutathione peroxidase family. |
| Subcellular Location | Cytoplasm. Note=Mainly cytoplasmic. |
| Subunit | Homotetramer. |
| Tissue Specificity | Mostly in liver and gastrointestinal tract, not found in heart or kidney. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx2/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004011 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 32967607 | RefSeq | NP_002074 | 190 | glutathione peroxidase 2 |
Identical Sequences to LMP004011 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32967607 | DBBJ | BAE17011.1 | 190 | glutathione peroxidase 2 [Hylobates lar] |
| GI:32967607 | GenBank | AAV31780.1 | 190 | glutathione peroxidase 2 (gastrointestinal) [Homo sapiens] |
| GI:32967607 | GenBank | AAH22820.2 | 190 | Glutathione peroxidase 2 (gastrointestinal) [Homo sapiens] |
| GI:32967607 | RefSeq | NP_001108606.1 | 190 | glutathione peroxidase 2 [Pan troglodytes] |
| GI:32967607 | SwissProt | P18283.3 | 190 | RecName: Full=Glutathione peroxidase 2; Short=GPx-2; Short=GSHPx-2; AltName: Full=Gastrointestinal glutathione peroxidase; AltName: Full=Glutathione peroxidase-gastrointestinal; Short=GPx-GI; Short=GSHPx-GI; AltName: Full=Glutathione peroxidase-related protein 2; Short=GPRP-2 [Homo sapiens] |
| GI:32967607 | SwissProt | Q4AEH9.2 | 190 | RecName: Full=Glutathione peroxidase 2; Short=GPx-2; Short=GSHPx-2; AltName: Full=Glutathione peroxidase-gastrointestinal; Short=GPx-GI; Short=GSHPx-GI [Hylobates lar] |
Related Sequences to LMP004011 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32967607 | EMBL | CAA48394.1 | 190 | glutathione peroxidase-GI [Homo sapiens] |
| GI:32967607 | GenBank | AAX40994.1 | 191 | glutathione peroxidase 2, partial [synthetic construct] |
| GI:32967607 | GenBank | AAX40995.1 | 191 | glutathione peroxidase 2, partial [synthetic construct] |
| GI:32967607 | GenBank | AHD74266.1 | 190 | Sequence 13632 from patent US 8586006 |
| GI:32967607 | RefSeq | XP_004055355.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Gorilla gorilla gorilla] |
| GI:32967607 | RefSeq | XP_004087207.1 | 190 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 2 [Nomascus leucogenys] |