Gene/Proteome Database (LMPD)
LMPD ID
LMP004129
Gene ID
Species
Mus musculus (Mouse)
Gene Name
phospholipid scramblase 1
Gene Symbol
Synonyms
MmTRA1a; MmTRA1b; Nor1; Tra1; Tra1a; Tra1b; Tras1; Tras2
Alternate Names
phospholipid scramblase 1; PL scramblase 1; transplantability-associated protein 1; ca(2+)-dependent phospholipid scramblase 1
Chromosome
9
Map Location
9 E3.3|9
Proteins
phospholipid scramblase 1 | |
---|---|
Refseq ID | NP_035766 |
Protein GI | 194328695 |
UniProt ID | Q9JJ00 |
mRNA ID | NM_011636 |
Length | 328 |
RefSeq Status | VALIDATED |
MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNCPPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005829 | IDA:UniProtKB | C | cytosol |
GO:0031012 | ISS:UniProtKB | C | extracellular matrix |
GO:0005794 | ISS:UniProtKB | C | Golgi apparatus |
GO:0005887 | ISS:UniProtKB | C | integral component of plasma membrane |
GO:0045121 | ISS:UniProtKB | C | membrane raft |
GO:0005730 | ISS:UniProtKB | C | nucleolus |
GO:0005634 | IDA:UniProtKB | C | nucleus |
GO:0005886 | IDA:UniProtKB | C | plasma membrane |
GO:0005509 | ISS:UniProtKB | F | calcium ion binding |
GO:0042609 | ISS:UniProtKB | F | CD4 receptor binding |
GO:0003677 | IEA:UniProtKB-KW | F | DNA binding |
GO:0005154 | ISS:UniProtKB | F | epidermal growth factor receptor binding |
GO:0017128 | ISS:UniProtKB | F | phospholipid scramblase activity |
GO:0001077 | ISS:UniProtKB | F | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription |
GO:0017124 | ISS:UniProtKB | F | SH3 domain binding |
GO:0006953 | IEP:UniProtKB | P | acute-phase response |
GO:0071345 | IEP:UniProtKB | P | cellular response to cytokine stimulus |
GO:0071222 | IEP:UniProtKB | P | cellular response to lipopolysaccharide |
GO:0051607 | IMP:UniProtKB | P | defense response to virus |
GO:0097193 | IDA:UniProtKB | P | intrinsic apoptotic signaling pathway |
GO:0030099 | IMP:MGI | P | myeloid cell differentiation |
GO:0032091 | IDA:MGI | P | negative regulation of protein binding |
GO:0045071 | IMP:UniProtKB | P | negative regulation of viral genome replication |
GO:0006659 | IDA:UniProtKB | P | phosphatidylserine biosynthetic process |
GO:0070782 | IDA:MGI | P | phosphatidylserine exposure on apoptotic cell surface |
GO:0017121 | IDA:UniProtKB | P | phospholipid scrambling |
GO:0043065 | IGI:MGI | P | positive regulation of apoptotic process |
GO:2000373 | ISS:UniProtKB | P | positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity |
GO:0045089 | IMP:UniProtKB | P | positive regulation of innate immune response |
GO:1902231 | IDA:MGI | P | positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage |
GO:0045944 | ISS:UniProtKB | P | positive regulation of transcription from RNA polymerase II promoter |
GO:0060368 | ISS:UniProtKB | P | regulation of Fc receptor mediated stimulatory signaling pathway |
GO:0033003 | ISS:UniProtKB | P | regulation of mast cell activation |
GO:0035455 | IMP:UniProtKB | P | response to interferon-alpha |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR005552 | Scramblase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000250}; |
Disease | Note=Participates in a chromosomal translocation that produces MMTRA1A which is leukemogenic to syngenic SL mice and athymic nude mice. |
Domain | The N-terminal proline-rich domain (PRD) is required for phospholipid scramblase activity. {ECO:0000250}. |
Function | May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. {ECO:0000269|PubMed:12010804}. |
Function | May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. May contribute to cytokine-regulated cell proliferation and differentiation. {ECO:0000269|PubMed:12010804}. |
Induction | Up-regulated by SCF/KITL and GCSF/CSF3. {ECO:0000269|PubMed:12010804}. |
Miscellaneous | Knockout newborn mice display a reduced granulocyte production. Hematopoietic precursor cell from knockout mice display defective colony formation and impaired differentiation to mature granulocytes as stimulated by SCF/KITL and GCSF/CSF3. |
Sequence Caution | Sequence=BAA23663.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAA23664.1; Type=Frameshift; Positions=92; Evidence={ECO:0000305}; |
Similarity | Belongs to the phospholipid scramblase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000250}; Single-pass type II membrane protein. Membrane; Lipid-anchor {ECO:0000250}; Cytoplasmic side. Nucleus {ECO:0000250}. |
Tissue Specificity | Highly expressed in kidney, lung, liver and bone marrow, slightly in spleen, heart and macrophage. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004129 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
194328695 | RefSeq | NP_035766 | 328 | phospholipid scramblase 1 |
Identical Sequences to LMP004129 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:194328695 | GenBank | AAF77076.1 | 328 | phospholipid scramblase 1 [Mus musculus] |
GI:194328695 | GenBank | EDL20917.1 | 328 | mCG17676 [Mus musculus] |
GI:194328695 | RefSeq | XP_006511115.1 | 328 | PREDICTED: phospholipid scramblase 1 isoform X1 [Mus musculus] |
GI:194328695 | SwissProt | Q9JJ00.1 | 328 | RecName: Full=Phospholipid scramblase 1; Short=PL scramblase 1; AltName: Full=Ca(2+)-dependent phospholipid scramblase 1; AltName: Full=Transplantability-associated protein 1; Short=NOR1; Short=TRA1 [Mus musculus] |
Related Sequences to LMP004129 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:194328695 | DBBJ | BAB22897.1 | 328 | unnamed protein product [Mus musculus] |
GI:194328695 | DBBJ | BAE29156.1 | 327 | unnamed protein product [Mus musculus] |
GI:194328695 | GenBank | AAH02017.1 | 327 | Plscr1 protein [Mus musculus] |
GI:194328695 | RefSeq | XP_005080791.1 | 328 | PREDICTED: phospholipid scramblase 1 [Mesocricetus auratus] |
GI:194328695 | RefSeq | XP_005366710.1 | 326 | PREDICTED: phospholipid scramblase 1 [Microtus ochrogaster] |
GI:194328695 | RefSeq | XP_006987008.1 | 334 | PREDICTED: phospholipid scramblase 1 [Peromyscus maniculatus bairdii] |