Gene/Proteome Database (LMPD)

LMPD ID
LMP004132
Gene ID
56375
Species
Mus musculus (Mouse)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Gene Symbol
B4galt4
Synonyms
9130402O08Rik; B4galt-IV; b4Gal-T4; beta4Gal-T4; beta4GalT-IV
Alternate Names
beta-1,4-galactosyltransferase 4; beta-1,4-GalTase 4; beta-1,4-galactosyltransferase IV; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4
Chromosome
16
Map Location
16|16 B4
EC Number
2.4.1.-

Proteins

beta-1,4-galactosyltransferase 4 precursor
Refseq ID NP_062778
Protein GI 188528672
UniProt ID Q9JJ04
mRNA ID NM_019804
Length 344
RefSeq Status VALIDATED
MGCNPPYHLSYRLRLLLLFTLCLTVVGWATSNYFVGAIQVIPKAKDFMASFHKVIHLGNEETLGHDGATKKPELANCPSVSPNLRGQSKLVFKPDLTLEEIEAENPKVSRGRYHPEECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA
sig_peptide: 1..29 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3351 peptide sequence: MGCNPPYHLSYRLRLLLLFTLCLTVVGWA sig_peptide: 1..29 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 3351 peptide sequence: MGCNPPYHLSYRLRLLLLFTLCLTVVGWA
beta-1,4-galactosyltransferase 4 precursor
Refseq ID NP_001272722
Protein GI 551410641
UniProt ID Q9JJ04
mRNA ID NM_001285793
Length 344
RefSeq Status VALIDATED
Protein sequence is identical to GI:188528672 (mRNA isoform)

Gene Information

Entrez Gene ID
56375
Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Gene Symbol
B4galt4
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003945 IEA:UniProtKB-EC F N-acetyllactosamine synthase activity
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0006486 IEA:UniProtKB-UniPathway P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
mmu00533 Glycosaminoglycan biosynthesis - keratan sulfate

REACTOME Pathway Links

REACTOME Pathway ID Description
5893854 Keratan sulfate biosynthesis
5893905 N-Glycan antennae elongation

Domain Information

InterPro Annotations

Accession Description
IPR003859 Beta-1,4-galactosyltransferase
IPR027791 Galactosyltransferase, C-terminal
IPR027995 Galactosyltransferase, N-terminal
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4
Protein Entry
B4GT4_MOUSE
UniProt ID
Q9JJ04
Species
Mouse

Comments

Comment Type Description
Catalytic Activity UDP-alpha-D-galactose + N-acetyl-D-glucosamine = UDP + N-acetyllactosamine.
Catalytic Activity UDP-alpha-D-galactose + N-acetyl-beta-D- glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide = UDP + beta-D-galactosyl-(1->4)-N-acetyl-beta-D- glucosaminyl-(1->3)-beta-D-galactosyl-(1->4)-beta-D-glucosyl- (1<->1)-ceramide.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250};
Function Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. {ECO:0000250}.
Pathway Protein modification; protein glycosylation.
Sequence Caution Sequence=BAC32433.1; Type=Frameshift; Positions=321; Evidence={ECO:0000305};
Similarity Belongs to the glycosyltransferase 7 family. {ECO:0000305}.
Subcellular Location Golgi apparatus, Golgi stack membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Trans cisternae of Golgi stack. {ECO:0000250}.
Web Resource Name=Functional Glycomics Gateway - GTase; Note=b4GalT4; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_mou_463";

Identical and Related Proteins

Unique RefSeq proteins for LMP004132 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
188528672 RefSeq NP_062778 344 beta-1,4-galactosyltransferase 4 precursor

Identical Sequences to LMP004132 proteins

Reference Database Accession Length Protein Name
GI:188528672 DBBJ BAC35443.1 344 unnamed protein product [Mus musculus]
GI:188528672 DBBJ BAC39433.1 344 unnamed protein product [Mus musculus]
GI:188528672 GenBank EDK97992.1 344 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4, isoform CRA_c [Mus musculus]
GI:188528672 RefSeq NP_001272722.1 344 beta-1,4-galactosyltransferase 4 precursor [Mus musculus]
GI:188528672 RefSeq XP_006522462.1 344 PREDICTED: beta-1,4-galactosyltransferase 4 isoform X1 [Mus musculus]
GI:188528672 SwissProt Q9JJ04.1 344 RecName: Full=Beta-1,4-galactosyltransferase 4; Short=Beta-1,4-GalTase 4; Short=Beta4Gal-T4; Short=b4Gal-T4; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; Includes: RecName: Full=N-acetyllactosamine synthase; AltName: Full=Nal synthase; Includes: RecName: Full=Lactotriaosylceramide beta-1,4-galactosyltransferase; AltName: Full=Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase [Mus musculus]

Related Sequences to LMP004132 proteins

Reference Database Accession Length Protein Name
GI:188528672 GenBank AAF22222.1 344 beta-1,4-galactosyltransferase IV [Mus musculus]
GI:188528672 GenBank AAH81866.1 344 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4 [Rattus norvegicus]
GI:188528672 GenBank EDK97990.1 394 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4, isoform CRA_a, partial [Mus musculus]
GI:188528672 GenBank EDK97993.1 408 UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 4, isoform CRA_d [Mus musculus]
GI:188528672 GenBank EDM11209.1 344 rCG52599, isoform CRA_a [Rattus norvegicus]
GI:188528672 SwissProt Q66HH1.1 344 RecName: Full=Beta-1,4-galactosyltransferase 4; Short=Beta-1,4-GalTase 4; Short=Beta4Gal-T4; Short=b4Gal-T4; AltName: Full=UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; AltName: Full=UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; Includes: RecName: Full=N-acetyllactosamine synthase; AltName: Full=Nal synthase; Includes: RecName: Full=Lactotriaosylceramide beta-1,4-galactosyltransferase; AltName: Full=Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase [Rattus norvegicus]