Gene/Proteome Database (LMPD)

LMPD ID
LMP004346
Gene ID
84095
Species
Mus musculus (Mouse)
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Pi4k2a
Synonyms
Pi4k2
Alternate Names
phosphatidylinositol 4-kinase type 2-alpha; phosphatidylinositol 4-kinase type II-alpha
Chromosome
19
Map Location
19 C3|19 35.74 cM
EC Number
2.7.1.67

Proteins

phosphatidylinositol 4-kinase type 2-alpha
Refseq ID NP_663476
Protein GI 21703986
UniProt ID Q2TBE6
mRNA ID NM_145501
Length 479
RefSeq Status VALIDATED
MDETSPLVSPERAQPPEYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPCSPGHDRERQPLLDRARGAAAQGQTHTVAVQAQALAAQAAVAAHAVQTHRERNDFPEDPEFEVVVRQAEVAIECSIYPERIYQGSSGSYFVKDSQGRIVAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDNSSCRDTDWVMVREPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFIKDLEEDLYELFKRDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSASESYTQSFQSRKPFFSWW

Gene Information

Entrez Gene ID
84095
Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Gene Symbol
Pi4k2a
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0031083 IEA:Ensembl C BLOC-1 complex
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0030054 IEA:UniProtKB-KW C cell junction
GO:0031410 ISS:UniProtKB C cytoplasmic vesicle
GO:0030425 IDA:UniProtKB C dendrite
GO:0031901 IEA:Ensembl C early endosome membrane
GO:0005768 ISS:UniProtKB C endosome
GO:0070382 IEA:Ensembl C exocytic vesicle
GO:0035838 ISS:UniProtKB C growing cell tip
GO:0044231 IDA:UniProtKB C host cell presynaptic membrane
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0005765 IEA:Ensembl C lysosomal membrane
GO:0045121 IEA:Ensembl C membrane raft
GO:0005739 IDA:UniProtKB C mitochondrion
GO:0043005 IDA:UniProtKB C neuron projection
GO:0043025 IDA:UniProtKB C neuronal cell body
GO:0043204 IEA:Ensembl C perikaryon
GO:0042734 IDA:UniProtKB C presynaptic membrane
GO:0030672 IEA:Ensembl C synaptic vesicle membrane
GO:0004430 IEA:UniProtKB-EC F 1-phosphatidylinositol 4-kinase activity
GO:0035651 ISS:UniProtKB F AP-3 adaptor complex binding
GO:0005524 IEA:UniProtKB-KW F ATP binding
GO:0002561 IEA:Ensembl P basophil degranulation
GO:0006661 IEA:Ensembl P phosphatidylinositol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
mmu00562 Inositol phosphate metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5894013 Synthesis of PIPs at the early endosome membrane
5894009 Synthesis of PIPs at the plasma membrane

Domain Information

InterPro Annotations

Accession Description
IPR000403 Phosphatidylinositol 3-/4-kinase, catalytic domain

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol 4-kinase type 2 alpha
Protein Entry
P4K2A_MOUSE
UniProt ID
Q2TBE6
Species
Mouse

Comments

Comment Type Description
Catalytic Activity ATP + 1-phosphatidyl-1D-myo-inositol = ADP + 1-phosphatidyl-1D-myo-inositol 4-phosphate.
Function Together with PI4K2B and the type III PI4Ks (PIK4CA and PIK4CB) it contributes to the overall PI4-kinase activity of the cell. The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3). Contributes to the production of InsP3 in stimulated cells. This lipid kinase is the major phosphatidylinositol 4-phosphate (PI4P) producer in the Golgi apparatus, it generates more than 50% of this molecule which is essential for the identity of the organelle, protein sorting and membrane trafficking (By similarity). {ECO:0000250}.
Interaction G3V8C2:Itch (xeno); NbExp=2; IntAct=EBI-8159115, EBI-8159149;
Ptm Palmitoylated by ZDHHC3 and ZDHHC7 in the CCPCC motif. Palmitoylation is cholesterol-dependent, and required for TGN localization (By similarity). {ECO:0000250}.
Similarity Belongs to the PI3/PI4-kinase family. Type II PI4K subfamily. {ECO:0000305}.
Similarity Contains 1 PI3K/PI4K domain. {ECO:0000305}.
Subcellular Location Cytoplasm {ECO:0000250}. Golgi apparatus, trans-Golgi network membrane {ECO:0000250}; Lipid-anchor {ECO:0000250}. Membrane raft {ECO:0000250}. Endosome {ECO:0000250}. Cytoplasmic vesicle {ECO:0000250}. Cell projection, dendrite {ECO:0000269|PubMed:21998198}. Cell junction, synapse, presynaptic cell membrane {ECO:0000269|PubMed:21998198}. Cell junction, synapse, synaptosome {ECO:0000269|PubMed:21998198}. Mitochondrion {ECO:0000269|PubMed:21998198}. Note=Found in subdomains of the plasma membrane termed non-caveolar membrane rafts. Enriched in neurite tips and neuron projections in a BLOC- 1- and AP-3-complexes-dependent manner (By similarity). Localized in neuronal cell body. Transported from neuronal cell body to neuron projections in a BLOC-1- and AP-3-complexes-dependent manner. {ECO:0000250}.
Subunit Associates with the BLOC-1 and the AP-3 complexes; the BLOC-1 complex is required for optimal binding of PI4K2A to the AP-3 complex. Interacts with BLOC1S5 and DTNBP1 (By similarity). Interacts with FOS; this interaction may enhance phosphatidylinositol phosphorylation activity. {ECO:0000250, ECO:0000269|PubMed:22105363}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004346 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21703986 RefSeq NP_663476 479 phosphatidylinositol 4-kinase type 2-alpha

Identical Sequences to LMP004346 proteins

Reference Database Accession Length Protein Name
GI:21703986 GenBank AAI10364.1 479 Phosphatidylinositol 4-kinase type 2 alpha [Mus musculus]
GI:21703986 SwissProt Q2TBE6.1 479 RecName: Full=Phosphatidylinositol 4-kinase type 2-alpha; AltName: Full=Phosphatidylinositol 4-kinase type II-alpha [Mus musculus]

Related Sequences to LMP004346 proteins

Reference Database Accession Length Protein Name
GI:21703986 GenBank AAK33002.1 478 55 kDa type II phosphatidylinositol 4-kinase [Rattus norvegicus]
GI:21703986 GenBank EDL94229.1 478 phosphatidylinositol 4-kinase type 2 alpha, isoform CRA_a [Rattus norvegicus]
GI:21703986 RefSeq NP_446187.1 478 phosphatidylinositol 4-kinase type 2-alpha [Rattus norvegicus]
GI:21703986 RefSeq XP_005352352.1 478 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Microtus ochrogaster]
GI:21703986 RefSeq XP_006990530.1 478 PREDICTED: phosphatidylinositol 4-kinase type 2-alpha [Peromyscus maniculatus bairdii]
GI:21703986 SwissProt Q99M64.1 478 RecName: Full=Phosphatidylinositol 4-kinase type 2-alpha; AltName: Full=55 kDa type II phosphatidylinositol 4-kinase; AltName: Full=Phosphatidylinositol 4-kinase type II-alpha [Rattus norvegicus]