Gene/Proteome Database (LMPD)
LMPD ID
LMP004411
Gene ID
Species
Homo sapiens (Human)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Synonyms
FACE; FAE; LCE
Alternate Names
elongation of very long chain fatty acids protein 6; hELO2; ELOVL FA elongase 6; fatty acid elongase 2; fatty acyl-CoA elongase; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase ELOVL6; very-long-chain 3-oxoacyl-CoA synthase 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)
Chromosome
4
Map Location
4q25
EC Number
2.3.1.199
Summary
Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation (Moon et al., 2001 [PubMed 11567032]).[supplied by OMIM, Mar 2008]
Orthologs
Proteins
elongation of very long chain fatty acids protein 6 | |
---|---|
Refseq ID | NP_076995 |
Protein GI | 13129088 |
UniProt ID | Q9H5J4 |
mRNA ID | NM_024090 |
Length | 265 |
RefSeq Status | VALIDATED |
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE |
elongation of very long chain fatty acids protein 6 | |
---|---|
Refseq ID | NP_001124193 |
Protein GI | 195539343 |
UniProt ID | Q9H5J4 |
mRNA ID | NM_001130721 |
Length | 265 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:13129088 (mRNA isoform) |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
GO:0005789 | TAS:Reactome | C | endoplasmic reticulum membrane |
GO:0030176 | IEA:Ensembl | C | integral component of endoplasmic reticulum membrane |
GO:0016747 | IEA:Ensembl | F | transferase activity, transferring acyl groups other than amino-acyl groups |
GO:0044255 | TAS:Reactome | P | cellular lipid metabolic process |
GO:0019367 | IDA:UniProtKB | P | fatty acid elongation, saturated fatty acid |
GO:0042759 | IDA:UniProtKB | P | long-chain fatty acid biosynthetic process |
GO:0035338 | TAS:Reactome | P | long-chain fatty-acyl-CoA biosynthetic process |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
GO:0019432 | TAS:Reactome | P | triglyceride biosynthetic process |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-5972 | stearate biosynthesis I (animals) |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_147904 | Activation of gene expression by SREBF (SREBP) |
REACT_380 | Synthesis of very long-chain fatty acyl-CoAs |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
Function | Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Highest activity toward C16:0 acyl-CoAs. |
Ptm | N-Glycosylated. |
Sequence Caution | Sequence=BAC11225.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the ELO family. |
Subcellular Location | Endoplasmic reticulum membrane ; Multi-pass membrane protein . |
Tissue Specificity | Ubiquitous. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004411 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
13129088 | RefSeq | NP_076995 | 265 | elongation of very long chain fatty acids protein 6 |
Identical Sequences to LMP004411 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13129088 | RefSeq | XP_008953642.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus] |
GI:13129088 | RefSeq | XP_003830073.2 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus] |
GI:13129088 | RefSeq | XP_008953643.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus] |
GI:13129088 | RefSeq | XP_009446414.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes] |
GI:13129088 | RefSeq | XP_003950444.2 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes] |
GI:13129088 | RefSeq | XP_009446415.1 | 265 | PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes] |
Related Sequences to LMP004411 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:13129088 | GenBank | ACP57529.1 | 265 | Sequence 105 from patent US 7491381 |
GI:13129088 | GenBank | ACP57530.1 | 265 | Sequence 106 from patent US 7491381 |
GI:13129088 | GenBank | ACP57531.1 | 265 | Sequence 107 from patent US 7491381 |
GI:13129088 | GenBank | ACP57532.1 | 265 | Sequence 108 from patent US 7491381 |
GI:13129088 | GenBank | ACP57533.1 | 265 | Sequence 109 from patent US 7491381 |
GI:13129088 | GenBank | ACP57534.1 | 265 | Sequence 110 from patent US 7491381 |