Gene/Proteome Database (LMPD)

LMPD ID
LMP004411
Gene ID
Species
Homo sapiens (Human)
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Synonyms
FACE; FAE; LCE
Alternate Names
elongation of very long chain fatty acids protein 6; hELO2; ELOVL FA elongase 6; fatty acid elongase 2; fatty acyl-CoA elongase; long-chain fatty-acyl elongase; 3-keto acyl-CoA synthase ELOVL6; very-long-chain 3-oxoacyl-CoA synthase 6; ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast)
Chromosome
4
Map Location
4q25
EC Number
2.3.1.199
Summary
Fatty acid elongases (EC 6.2.1.3), such as ELOVL6, use malonyl-CoA as a 2-carbon donor in the first and rate-limiting step of fatty acid elongation (Moon et al., 2001 [PubMed 11567032]).[supplied by OMIM, Mar 2008]
Orthologs

Proteins

elongation of very long chain fatty acids protein 6
Refseq ID NP_076995
Protein GI 13129088
UniProt ID Q9H5J4
mRNA ID NM_024090
Length 265
RefSeq Status VALIDATED
MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMVYILMTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTKAE
elongation of very long chain fatty acids protein 6
Refseq ID NP_001124193
Protein GI 195539343
UniProt ID Q9H5J4
mRNA ID NM_001130721
Length 265
RefSeq Status VALIDATED
Protein sequence is identical to GI:13129088 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
ELOVL fatty acid elongase 6
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0005789 TAS:Reactome C endoplasmic reticulum membrane
GO:0030176 IEA:Ensembl C integral component of endoplasmic reticulum membrane
GO:0016747 IEA:Ensembl F transferase activity, transferring acyl groups other than amino-acyl groups
GO:0044255 TAS:Reactome P cellular lipid metabolic process
GO:0019367 IDA:UniProtKB P fatty acid elongation, saturated fatty acid
GO:0042759 IDA:UniProtKB P long-chain fatty acid biosynthetic process
GO:0035338 TAS:Reactome P long-chain fatty-acyl-CoA biosynthetic process
GO:0044281 TAS:Reactome P small molecule metabolic process
GO:0019432 TAS:Reactome P triglyceride biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5972 stearate biosynthesis I (animals)

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_147904 Activation of gene expression by SREBF (SREBP)
REACT_380 Synthesis of very long-chain fatty acyl-CoAs

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
ELOVL fatty acid elongase 6
Protein Entry
ELOV6_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2).
Function Condensing enzyme that catalyzes the synthesis of saturated and monounsaturated fatty acids. Highest activity toward C16:0 acyl-CoAs.
Ptm N-Glycosylated.
Sequence Caution Sequence=BAC11225.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the ELO family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .
Tissue Specificity Ubiquitous.

Identical and Related Proteins

Unique RefSeq proteins for LMP004411 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13129088 RefSeq NP_076995 265 elongation of very long chain fatty acids protein 6

Identical Sequences to LMP004411 proteins

Reference Database Accession Length Protein Name
GI:13129088 RefSeq XP_008953642.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus]
GI:13129088 RefSeq XP_003830073.2 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus]
GI:13129088 RefSeq XP_008953643.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan paniscus]
GI:13129088 RefSeq XP_009446414.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes]
GI:13129088 RefSeq XP_003950444.2 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes]
GI:13129088 RefSeq XP_009446415.1 265 PREDICTED: elongation of very long chain fatty acids protein 6 isoform X1 [Pan troglodytes]

Related Sequences to LMP004411 proteins

Reference Database Accession Length Protein Name
GI:13129088 GenBank ACP57529.1 265 Sequence 105 from patent US 7491381
GI:13129088 GenBank ACP57530.1 265 Sequence 106 from patent US 7491381
GI:13129088 GenBank ACP57531.1 265 Sequence 107 from patent US 7491381
GI:13129088 GenBank ACP57532.1 265 Sequence 108 from patent US 7491381
GI:13129088 GenBank ACP57533.1 265 Sequence 109 from patent US 7491381
GI:13129088 GenBank ACP57534.1 265 Sequence 110 from patent US 7491381