Gene/Proteome Database (LMPD)

LMPD ID
LMP004426
Gene ID
12801
Species
Mus musculus (Mouse)
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Cnr1
Synonyms
CB-R; CB1; CB1R
Alternate Names
cannabinoid receptor 1; brain-type cannabinoid receptor; striatal cannabinoid receptor type 1 protein
Chromosome
4
Map Location
4 A5|4 16.28 cM

Proteins

cannabinoid receptor 1
Refseq ID NP_031752
Protein GI 6724315
UniProt ID P47746
mRNA ID NM_007726
Length 473
RefSeq Status VALIDATED
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNSPLVPAGDTTNITEFYNKSLSSFKENEDNIQCGENFMDMECFMILNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFVDFHVFHRKDSPNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLMWTIAIVIAVLPLLGWNCKKLQSVCSDIFPLIDETYLMFWIGVTSVLLLFIVYAYMYILWKAHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLLAIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQPLDNSMGDSDCLHKHANNTASMHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

Gene Information

Entrez Gene ID
12801
Gene Name
cannabinoid receptor 1 (brain)
Gene Symbol
Cnr1
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030424 IDA:MGI C axon
GO:0030426 IDA:MGI C growth cone
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0004949 ISS:UniProtKB F cannabinoid receptor activity
GO:0008144 IEA:Ensembl F drug binding
GO:0007188 ISS:UniProtKB P adenylate cyclase-modulating G-protein coupled receptor signaling pathway
GO:0007568 IEA:Ensembl P aging
GO:0007413 IMP:MGI P axonal fasciculation
GO:0042593 IPI:MGI P glucose homeostasis
GO:0060135 IEA:Ensembl P maternal process involved in female pregnancy
GO:0007613 IEA:Ensembl P memory
GO:0045759 IEA:Ensembl P negative regulation of action potential
GO:0045776 IEA:Ensembl P negative regulation of blood pressure
GO:0033602 IEA:Ensembl P negative regulation of dopamine secretion
GO:0031999 IEA:Ensembl P negative regulation of fatty acid beta-oxidation
GO:0033004 IEA:Ensembl P negative regulation of mast cell activation
GO:0051001 IEA:Ensembl P negative regulation of nitric-oxide synthase activity
GO:0002866 IEA:Ensembl P positive regulation of acute inflammatory response to antigenic stimulus
GO:0043065 IEA:Ensembl P positive regulation of apoptotic process
GO:0045777 IEA:Ensembl P positive regulation of blood pressure
GO:0031622 IEA:Ensembl P positive regulation of fever generation
GO:0010976 IEA:Ensembl P positive regulation of neuron projection development
GO:0060259 IEA:Ensembl P regulation of feeding behavior
GO:0050796 IEA:Ensembl P regulation of insulin secretion
GO:0060405 IEA:Ensembl P regulation of penile erection
GO:0032228 IEA:Ensembl P regulation of synaptic transmission, GABAergic
GO:0051966 IEA:Ensembl P regulation of synaptic transmission, glutamatergic
GO:0042220 IEA:Ensembl P response to cocaine
GO:0045471 IEA:Ensembl P response to ethanol
GO:0032496 IEA:Ensembl P response to lipopolysaccharide
GO:0043278 IEA:Ensembl P response to morphine
GO:0035094 IEA:Ensembl P response to nicotine
GO:0007584 IEA:Ensembl P response to nutrient
GO:0019233 IEA:Ensembl P sensory perception of pain
GO:0007283 IEA:Ensembl P spermatogenesis

KEGG Pathway Links

KEGG Pathway ID Description
mmu04015 Rap1 signaling pathway
mmu04723 Retrograde endocannabinoid signaling

Domain Information

InterPro Annotations

Accession Description
IPR002230 Cannabinoid receptor family
IPR000810 Cannabinoid receptor type 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cannabinoid receptor 1 (brain)
Protein Entry
CNR1_MOUSE
UniProt ID
P47746
Species
Mouse

Comments

Comment Type Description
Function Involved in cannabinoid-induced CNS effects. Acts by inhibiting adenylate cyclase. Could be a receptor for anandamide. Inhibits L-type Ca(2+) channel current.
Ptm Palmitoylation at Cys-416 is important for recruitment at both plasma membrane and lipid rafts. {ECO:0000250}.
Similarity Belongs to the G-protein coupled receptor 1 family. {ECO:0000255|PROSITE-ProRule:PRU00521}.
Subcellular Location Cell membrane; Multi-pass membrane protein.
Subunit Interacts (via C-terminus) with CNRIP1. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP004426 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6724315 RefSeq NP_031752 473 cannabinoid receptor 1

Identical Sequences to LMP004426 proteins

Reference Database Accession Length Protein Name
GI:6724315 GenBank EDL05482.1 473 mCG12569 [Mus musculus]
GI:6724315 RefSeq XP_006537654.1 473 PREDICTED: cannabinoid receptor 1 isoform X1 [Mus musculus]
GI:6724315 RefSeq XP_006537655.1 473 PREDICTED: cannabinoid receptor 1 isoform X2 [Mus musculus]
GI:6724315 RefSeq XP_006537656.1 473 PREDICTED: cannabinoid receptor 1 isoform X3 [Mus musculus]
GI:6724315 RefSeq XP_006537657.1 473 PREDICTED: cannabinoid receptor 1 isoform X4 [Mus musculus]
GI:6724315 RefSeq XP_006537658.1 473 PREDICTED: cannabinoid receptor 1 isoform X5 [Mus musculus]

Related Sequences to LMP004426 proteins

Reference Database Accession Length Protein Name
GI:6724315 EMBL CAA39332.1 473 CB1 cannabinoid receptor [Rattus norvegicus]
GI:6724315 GenBank AAA99067.1 473 neuronal cannabinoid receptor [Rattus norvegicus]
GI:6724315 GenBank EDL98589.1 473 cannabinoid receptor 1 (brain) [Rattus norvegicus]
GI:6724315 PRF - 473 cannabinoid receptor [Rattus norvegicus]
GI:6724315 RefSeq NP_036916.1 473 cannabinoid receptor 1 [Rattus norvegicus]
GI:6724315 SwissProt P20272.1 473 RecName: Full=Cannabinoid receptor 1; Short=CB-R; Short=CB1; AltName: Full=Brain-type cannabinoid receptor [Rattus norvegicus]