Gene/Proteome Database (LMPD)
Proteins
| serum deprivation-response protein | |
|---|---|
| Refseq ID | NP_620080 |
| Protein GI | 20270267 |
| UniProt ID | Q63918 |
| mRNA ID | NM_138741 |
| Length | 418 |
| RefSeq Status | PROVISIONAL |
| MGEDAAQAEKFQHPNTDMLQEKPSSPSPMPSSTPSPSLNLGSTEEAIRDNSQVNAVTVHTLLDKLVNMLDAVRENQHNMEQRQINLEGSVKGIQNDLTKLSKYQASTSNTVSKLLEKSRKVSAHTRAVRERLERQCVQVKRLENNHAQLLRRNHFKVLIFQEESEIPASVFVKEPVPSAAEGKEELADENKSLEETLHNVDLSSDDELPRDEEALEDSAEEKMEESRAEKIKRSSLKKVDSLKKAFSRQNIEKKMNKLGTKIVSVERREKIKKSLTPNHQKASSGKSSPFKVSPLSFGRKKVREGESSVENETKLEDQMQEDREEGSFTEGLSEASLPSGLMEGSAEDAEKSARRGNNSAVGSNADLTIEEDEEEEPVALQQAQQVRYESGYMLNSEEMEEPSEKQVQPAVLHVDQTA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | ISO:MGI | C | cytoplasm |
| GO:0005829 | ISS:UniProtKB | C | cytosol |
| GO:0016020 | IEA:UniProtKB-KW | C | membrane |
| GO:0001786 | ISS:UniProtKB | F | phosphatidylserine binding |
| GO:0045944 | ISO:MGI | P | positive regulation of transcription from RNA polymerase II promoter |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR026752 | Cavin family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Developmental Stage | Expression gradually increases during embryonic stages and reaches a maximum in neonates. |
| Function | May play a role in targeting PRKCA to caveolae. |
| Induction | Up-regulated in response to cardiac hypertrophy and in serum-starved but not in density-dependent growth-arrested NIH3T3 cells. Down-regulated within 6 hours after the addition of serum or epidermal growth factor to serum-starved cells. |
| Miscellaneous | Binds phosphatidylserine (PS) in a calcium- independent manner. PS-binding is inhibited by phosphotidic acid and phosphatidylinositol. Does not bind phosphatidylcholine (By similarity). |
| Ptm | The N-terminus is blocked. |
| Similarity | Belongs to the PTRF/SDPR family. |
| Subcellular Location | Cytoplasm, cytosol {ECO:0000269|PubMed:18332105}. Membrane, caveola . Note=Colocalizes with CAV1 to caveolae. |
| Subunit | Binds to PRKCA in the presence of phosphatidylserine. Interacts with MURC; this augments the transactivation of NPPA by MURC (By similarity). |
| Tissue Specificity | Highly expressed in kidney, lung and heart, and expressed at lower levels in liver, spleen, thymus, stomach, intestine and uterus. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004462 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 20270267 | RefSeq | NP_620080 | 418 | serum deprivation-response protein |
Identical Sequences to LMP004462 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20270267 | DBBJ | BAC39116.1 | 418 | unnamed protein product [Mus musculus] |
| GI:20270267 | GenBank | AAB28953.1 | 418 | activated c-raf oncogenic fusion protein homolog [Mus sp.] |
| GI:20270267 | GenBank | AAH20008.1 | 418 | Serum deprivation response [Mus musculus] |
| GI:20270267 | GenBank | AAH27005.1 | 418 | Serum deprivation response [Mus musculus] |
| GI:20270267 | GenBank | EDK96855.1 | 418 | serum deprivation response [Mus musculus] |
| GI:20270267 | SwissProt | Q63918.3 | 418 | RecName: Full=Serum deprivation-response protein; AltName: Full=Cavin-2; AltName: Full=Phosphatidylserine-binding protein [Mus musculus] |
Related Sequences to LMP004462 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:20270267 | DBBJ | BAC29033.1 | 418 | unnamed protein product [Mus musculus] |
| GI:20270267 | DBBJ | BAE21104.1 | 418 | unnamed protein product [Mus musculus] |
| GI:20270267 | GenBank | AAH81956.1 | 417 | Serum deprivation response [Rattus norvegicus] |
| GI:20270267 | GenBank | EDL99083.1 | 417 | serum deprivation response protein [Rattus norvegicus] |
| GI:20270267 | RefSeq | NP_001007713.1 | 417 | serum deprivation-response protein [Rattus norvegicus] |
| GI:20270267 | SwissProt | Q66H98.3 | 417 | RecName: Full=Serum deprivation-response protein; AltName: Full=Cavin-2; AltName: Full=Phosphatidylserine-binding protein [Rattus norvegicus] |