Gene/Proteome Database (LMPD)

LMPD ID
LMP004586
Gene ID
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 7
Gene Symbol
Synonyms
CL683; GPX6; GPx-7; GSHPx-7; NPGPx
Alternate Names
glutathione peroxidase 7; glutathione peroxidase 6; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase
Chromosome
1
Map Location
1p32
EC Number
1.11.1.9

Proteins

glutathione peroxidase 7 precursor
Refseq ID NP_056511
Protein GI 15618997
UniProt ID Q96SL4
mRNA ID NM_015696
Length 187
RefSeq Status VALIDATED
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1903 peptide sequence: MVAATVAAAWLLLWAAACA mat_peptide: 20..187 product: Glutathione peroxidase 7 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q96SL4.1) calculated_mol_wt: 19111 peptide sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase 7
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:UniProtKB C endoplasmic reticulum
GO:0005788 TAS:Reactome C endoplasmic reticulum lumen
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0004601 EXP:Reactome F peroxidase activity
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
hsa00590 Arachidonic acid metabolism
hsa00480 Glutathione metabolism
hsa04918 Thyroid hormone synthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_172715 Detoxification of Reactive Oxygen Species

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR013376 Glutathione peroxidase Gpx7, putative
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 7
Protein Entry
GPX7_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Disease Barrett esophagus (BE) [MIM
Function It protects esophageal epithelia from hydrogen peroxide- induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks.
Sequence Caution Sequence=AAC72961.1; Type=Erroneous translation; Note=Wrong choice of frame.; Evidence= ;
Similarity Belongs to the glutathione peroxidase family.
Subcellular Location Secreted .
Tissue Specificity Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids.
Web Resource Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx7/";

Identical and Related Proteins

Unique RefSeq proteins for LMP004586 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
15618997 RefSeq NP_056511 187 glutathione peroxidase 7 precursor

Identical Sequences to LMP004586 proteins

Reference Database Accession Length Protein Name
GI:15618997 GenBank AEU55298.1 187 Sequence 426 from patent US 8063186
GI:15618997 GenBank JAA04483.1 187 glutathione peroxidase 7 [Pan troglodytes]
GI:15618997 GenBank JAA18151.1 187 glutathione peroxidase 7 [Pan troglodytes]
GI:15618997 GenBank JAA24470.1 187 glutathione peroxidase 7 [Pan troglodytes]
GI:15618997 GenBank JAA35018.1 187 glutathione peroxidase 7 [Pan troglodytes]
GI:15618997 GenBank AIC54501.1 187 GPX7, partial [synthetic construct]

Related Sequences to LMP004586 proteins

Reference Database Accession Length Protein Name
GI:15618997 GenBank AAE70578.1 187 Sequence 1 from patent US 6231853
GI:15618997 RefSeq XP_003891940.1 184 PREDICTED: glutathione peroxidase 7 [Papio anubis]
GI:15618997 RefSeq XP_005543413.1 184 PREDICTED: glutathione peroxidase 7 [Macaca fascicularis]
GI:15618997 RefSeq XP_007976928.1 186 PREDICTED: glutathione peroxidase 7 [Chlorocebus sabaeus]
GI:15618997 RefSeq XP_008065748.1 186 PREDICTED: glutathione peroxidase 7 [Tarsius syrichta]
GI:15618997 RefSeq XP_010370425.1 193 PREDICTED: glutathione peroxidase 7 [Rhinopithecus roxellana]