Gene/Proteome Database (LMPD)
LMPD ID
LMP004586
Gene ID
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 7
Gene Symbol
Synonyms
CL683; GPX6; GPx-7; GSHPx-7; NPGPx
Alternate Names
glutathione peroxidase 7; glutathione peroxidase 6; non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase
Chromosome
1
Map Location
1p32
EC Number
1.11.1.9
Proteins
glutathione peroxidase 7 precursor | |
---|---|
Refseq ID | NP_056511 |
Protein GI | 15618997 |
UniProt ID | Q96SL4 |
mRNA ID | NM_015696 |
Length | 187 |
RefSeq Status | VALIDATED |
MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL | |
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1903 peptide sequence: MVAATVAAAWLLLWAAACA mat_peptide: 20..187 product: Glutathione peroxidase 7 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q96SL4.1) calculated_mol_wt: 19111 peptide sequence: QQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQLQRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEPTWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:UniProtKB | C | endoplasmic reticulum |
GO:0005788 | TAS:Reactome | C | endoplasmic reticulum lumen |
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0004602 | IEA:UniProtKB-EC | F | glutathione peroxidase activity |
GO:0004601 | EXP:Reactome | F | peroxidase activity |
GO:0006979 | IEA:InterPro | P | response to oxidative stress |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa00590 | Arachidonic acid metabolism |
hsa00480 | Glutathione metabolism |
hsa04918 | Thyroid hormone synthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_172715 | Detoxification of Reactive Oxygen Species |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
Disease | Barrett esophagus (BE) [MIM |
Function | It protects esophageal epithelia from hydrogen peroxide- induced oxidative stress. It suppresses acidic bile acid-induced reactive oxigen species (ROS) and protects against oxidative DNA damage and double-strand breaks. |
Sequence Caution | Sequence=AAC72961.1; Type=Erroneous translation; Note=Wrong choice of frame.; Evidence= ; |
Similarity | Belongs to the glutathione peroxidase family. |
Subcellular Location | Secreted . |
Tissue Specificity | Expressed in esophageal epithelial cells; expression is up-regulated after exposure to acidic bile acids. |
Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx7/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004586 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
15618997 | RefSeq | NP_056511 | 187 | glutathione peroxidase 7 precursor |
Identical Sequences to LMP004586 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15618997 | GenBank | AEU55298.1 | 187 | Sequence 426 from patent US 8063186 |
GI:15618997 | GenBank | JAA04483.1 | 187 | glutathione peroxidase 7 [Pan troglodytes] |
GI:15618997 | GenBank | JAA18151.1 | 187 | glutathione peroxidase 7 [Pan troglodytes] |
GI:15618997 | GenBank | JAA24470.1 | 187 | glutathione peroxidase 7 [Pan troglodytes] |
GI:15618997 | GenBank | JAA35018.1 | 187 | glutathione peroxidase 7 [Pan troglodytes] |
GI:15618997 | GenBank | AIC54501.1 | 187 | GPX7, partial [synthetic construct] |
Related Sequences to LMP004586 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:15618997 | GenBank | AAE70578.1 | 187 | Sequence 1 from patent US 6231853 |
GI:15618997 | RefSeq | XP_003891940.1 | 184 | PREDICTED: glutathione peroxidase 7 [Papio anubis] |
GI:15618997 | RefSeq | XP_005543413.1 | 184 | PREDICTED: glutathione peroxidase 7 [Macaca fascicularis] |
GI:15618997 | RefSeq | XP_007976928.1 | 186 | PREDICTED: glutathione peroxidase 7 [Chlorocebus sabaeus] |
GI:15618997 | RefSeq | XP_008065748.1 | 186 | PREDICTED: glutathione peroxidase 7 [Tarsius syrichta] |
GI:15618997 | RefSeq | XP_010370425.1 | 193 | PREDICTED: glutathione peroxidase 7 [Rhinopithecus roxellana] |