Gene/Proteome Database (LMPD)
LMPD ID
LMP004615
Gene ID
Species
Homo sapiens (Human)
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
Gene Symbol
Synonyms
B4Gal-T5; BETA4-GALT-IV; beta4Gal-T5; beta4GalT-V; gt-V
Alternate Names
beta-1,4-galactosyltransferase 5; beta4-GalT IV; beta-1,4-GalT II; beta-1,4-GalT IV; beta-1,4-GalTase 5; beta-1.4-galactosyltransferase V; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 5; UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 5
Chromosome
20
Map Location
20q13.1-q13.2
EC Number
2.4.1.-
Summary
This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
beta-1,4-galactosyltransferase 5 | |
---|---|
Refseq ID | NP_004767 |
Protein GI | 4757828 |
UniProt ID | O43286 |
mRNA ID | NM_004776 |
Length | 388 |
RefSeq Status | VALIDATED |
MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLRSAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHELFSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNRAMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKERQGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY |
Gene Information
Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
GO:0000139 | TAS:Reactome | C | Golgi membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0008378 | TAS:ProtInc | F | galactosyltransferase activity |
GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
GO:0005975 | TAS:Reactome | P | carbohydrate metabolic process |
GO:0044267 | TAS:Reactome | P | cellular protein metabolic process |
GO:0030203 | TAS:Reactome | P | glycosaminoglycan metabolic process |
GO:0018146 | TAS:Reactome | P | keratan sulfate biosynthetic process |
GO:0042339 | TAS:Reactome | P | keratan sulfate metabolic process |
GO:0016266 | TAS:Reactome | P | O-glycan processing |
GO:0043687 | TAS:Reactome | P | post-translational protein modification |
GO:0018279 | TAS:Reactome | P | protein N-linked glycosylation via asparagine |
GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa00512 | Mucin type O-Glycan biosynthesis |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_121120 | Keratan sulfate biosynthesis |
REACT_25085 | N-Glycan antennae elongation |
REACT_200727 | O-linked glycosylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5
Protein Entry
B4GT5_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Mn(2+); Xref=ChEBI |
Function | Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 7 family. |
Subcellular Location | Golgi apparatus, Golgi stack membrane; Single-pass type II membrane protein. Note=Trans cisternae of Golgi stack. |
Tissue Specificity | Ubiquitously expressed. |
Web Resource | Name=Functional Glycomics Gateway - GTase; Note=Beta-1,4-galactosyltransferase 5; URL="http://www.functionalglycomics.org/glycomics/molecule/jsp/glycoEnzyme/viewGlycoEnzyme.jsp?gbpId=gt_hum_440"; |
Web Resource | Name=GGDB; Note=GlycoGene database; URL="http://jcggdb.jp/rcmg/ggdb/Homolog?cat=symbol&symbol=B4GALT5"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004615 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
4757828 | RefSeq | NP_004767 | 388 | beta-1,4-galactosyltransferase 5 |
Identical Sequences to LMP004615 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4757828 | GenBank | ADC20515.1 | 388 | Sequence 999 from patent US 7638288 |
GI:4757828 | GenBank | ADR82962.1 | 388 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5, partial [synthetic construct] |
GI:4757828 | GenBank | AEF79564.1 | 388 | Sequence 2 from patent US 7943820 |
GI:4757828 | GenBank | AGD01476.1 | 388 | Sequence 999 from patent US 8338124 |
GI:4757828 | GenBank | AHD70030.1 | 388 | Sequence 2119 from patent US 8586006 |
GI:4757828 | GenBank | AIC50333.1 | 388 | B4GALT5, partial [synthetic construct] |
Related Sequences to LMP004615 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:4757828 | DBBJ | BAO04294.2 | 379 | beta-1,4-galactosyltransferase 5, partial [Homo sapiens] |
GI:4757828 | GenBank | JAA05671.1 | 388 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [Pan troglodytes] |
GI:4757828 | GenBank | JAA12702.1 | 388 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [Pan troglodytes] |
GI:4757828 | GenBank | JAA22790.1 | 388 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [Pan troglodytes] |
GI:4757828 | GenBank | JAA36919.1 | 388 | UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 [Pan troglodytes] |
GI:4757828 | RefSeq | XP_001167173.1 | 388 | PREDICTED: beta-1,4-galactosyltransferase 5 [Pan troglodytes] |