Gene/Proteome Database (LMPD)
LMPD ID
LMP004662
Gene ID
Species
Homo sapiens (Human)
Gene Name
arylacetamide deacetylase
Gene Symbol
Synonyms
CES5A1; DAC
Alternate Names
arylacetamide deacetylase; arylacetamide deacetylase (esterase)
Chromosome
3
Map Location
3q25.1
EC Number
3.1.1.3
Summary
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]
Orthologs
Proteins
arylacetamide deacetylase | |
---|---|
Refseq ID | NP_001077 |
Protein GI | 68299767 |
UniProt ID | P22760 |
mRNA ID | NM_001086 |
Length | 399 |
RefSeq Status | REVIEWED |
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IDA:UniProtKB | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0003824 | TAS:ProtInc | F | catalytic activity |
GO:0019213 | IDA:UniProtKB | F | deacetylase activity |
GO:0016298 | TAS:UniProtKB | F | lipase activity |
GO:0017171 | IDA:UniProtKB | F | serine hydrolase activity |
GO:0004806 | ISS:UniProtKB | F | triglyceride lipase activity |
GO:0010898 | ISS:UniProtKB | P | positive regulation of triglyceride catabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=0.8 mM for flutamide {ECO |
Catalytic Activity | Triacylglycerol + H(2)O = diacylglycerol + a carboxylate. |
Function | Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. {ECO |
Induction | Down-regulated following infection with hepatis C virus which results in impaired triacylglycerol lipolysis and impaired assembly of very low density lipoproteins. This may represent a cellular adaptation to infection that is aimed at limiting viral production. |
Miscellaneous | Can hydrolyze a number of clinical drugs such as flutamide, an antiandrogen drug used for the treatment of prostate cancer; phenacetin, an analgesic antipyretic which has been withdrawn from the market due to its links with renal failure; and rifamycins which have been used as antituberculosis drugs. |
Polymorphism | Three alleles are known: AADAC*1, AADAC*2 and AADAC*3. The sequence shown is that of AADAC*1 which is found in European American, African American, Japanese and Korean populations at allelic frequencies of 39.3 to 47.4%. The AADAC*2 allele is found in European American, African American, Korean, and Japanese populations at allelic frequencies of 52.6 to 63.5% whereas the AADAC*3 allele is found in European American (1.3%) and African American (2.0%) samples but not in Japanese or Korean samples. |
Ptm | Glycosylation is required for enzyme activity. |
Sequence Caution | Sequence=AAA35551.1; Type=Frameshift; Positions=53, 56; Evidence= ; |
Similarity | Belongs to the 'GDXG' lipolytic enzyme family. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type II membrane protein. Microsome membrane; Single-pass type II membrane protein. |
Tissue Specificity | Detected in liver (at protein level). Mainly expressed in liver, small intestine, colon, adrenal gland and bladder. {ECO |
Identical and Related Proteins
Unique RefSeq proteins for LMP004662 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
68299767 | RefSeq | NP_001077 | 399 | arylacetamide deacetylase |
Identical Sequences to LMP004662 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68299767 | GenBank | AAH32309.1 | 399 | Arylacetamide deacetylase (esterase) [Homo sapiens] |
GI:68299767 | GenBank | AHE01083.1 | 399 | Sequence 55999 from patent US 8586006 |
GI:68299767 | RefSeq | XP_005247160.1 | 399 | PREDICTED: arylacetamide deacetylase isoform X1 [Homo sapiens] |
GI:68299767 | SwissProt | P22760.5 | 399 | RecName: Full=Arylacetamide deacetylase [Homo sapiens] |
Related Sequences to LMP004662 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:68299767 | DBBJ | BAF83317.1 | 399 | unnamed protein product [Homo sapiens] |
GI:68299767 | GenBank | EAW78791.1 | 399 | arylacetamide deacetylase (esterase), isoform CRA_a [Homo sapiens] |
GI:68299767 | GenBank | EAW78792.1 | 399 | arylacetamide deacetylase (esterase), isoform CRA_a [Homo sapiens] |
GI:68299767 | RefSeq | XP_001145851.1 | 399 | PREDICTED: arylacetamide deacetylase [Pan troglodytes] |
GI:68299767 | RefSeq | XP_003826504.1 | 399 | PREDICTED: arylacetamide deacetylase [Pan paniscus] |
GI:68299767 | RefSeq | XP_008950113.1 | 399 | PREDICTED: arylacetamide deacetylase [Pan paniscus] |