Gene/Proteome Database (LMPD)

LMPD ID
LMP004662
Gene ID
13
Species
Homo sapiens (Human)
Gene Name
arylacetamide deacetylase
Gene Symbol
Synonyms
CES5A1; DAC
Alternate Names
arylacetamide deacetylase; arylacetamide deacetylase (esterase)
Chromosome
3
Map Location
3q25.1
EC Number
3.1.1.3
Summary
Microsomal arylacetamide deacetylase competes against the activity of cytosolic arylamine N-acetyltransferase, which catalyzes one of the initial biotransformation pathways for arylamine and heterocyclic amine carcinogens [provided by RefSeq, Jul 2008]
Orthologs

Proteins

arylacetamide deacetylase
Refseq ID NP_001077
Protein GI 68299767
UniProt ID P22760
mRNA ID NM_001086
Length 399
RefSeq Status REVIEWED
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Gene Information

Entrez Gene ID
13
Gene Name
arylacetamide deacetylase
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003824 TAS:ProtInc F catalytic activity
GO:0019213 IDA:UniProtKB F deacetylase activity
GO:0016298 TAS:UniProtKB F lipase activity
GO:0017171 IDA:UniProtKB F serine hydrolase activity
GO:0004806 ISS:UniProtKB F triglyceride lipase activity
GO:0010898 ISS:UniProtKB P positive regulation of triglyceride catabolic process

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR013094 Alpha/beta hydrolase fold-3
IPR017157 Arylacetamide deacetylase
IPR002168 Lipase, GDXG, active site

UniProt Annotations

Entry Information

Gene Name
arylacetamide deacetylase
Protein Entry
AAAD_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=0.8 mM for flutamide {ECO
Catalytic Activity Triacylglycerol + H(2)O = diacylglycerol + a carboxylate.
Function Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity. {ECO
Induction Down-regulated following infection with hepatis C virus which results in impaired triacylglycerol lipolysis and impaired assembly of very low density lipoproteins. This may represent a cellular adaptation to infection that is aimed at limiting viral production.
Miscellaneous Can hydrolyze a number of clinical drugs such as flutamide, an antiandrogen drug used for the treatment of prostate cancer; phenacetin, an analgesic antipyretic which has been withdrawn from the market due to its links with renal failure; and rifamycins which have been used as antituberculosis drugs.
Polymorphism Three alleles are known: AADAC*1, AADAC*2 and AADAC*3. The sequence shown is that of AADAC*1 which is found in European American, African American, Japanese and Korean populations at allelic frequencies of 39.3 to 47.4%. The AADAC*2 allele is found in European American, African American, Korean, and Japanese populations at allelic frequencies of 52.6 to 63.5% whereas the AADAC*3 allele is found in European American (1.3%) and African American (2.0%) samples but not in Japanese or Korean samples.
Ptm Glycosylation is required for enzyme activity.
Sequence Caution Sequence=AAA35551.1; Type=Frameshift; Positions=53, 56; Evidence= ;
Similarity Belongs to the 'GDXG' lipolytic enzyme family.
Subcellular Location Endoplasmic reticulum membrane; Single-pass type II membrane protein. Microsome membrane; Single-pass type II membrane protein.
Tissue Specificity Detected in liver (at protein level). Mainly expressed in liver, small intestine, colon, adrenal gland and bladder. {ECO

Identical and Related Proteins

Unique RefSeq proteins for LMP004662 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
68299767 RefSeq NP_001077 399 arylacetamide deacetylase

Identical Sequences to LMP004662 proteins

Reference Database Accession Length Protein Name
GI:68299767 GenBank AAH32309.1 399 Arylacetamide deacetylase (esterase) [Homo sapiens]
GI:68299767 GenBank AHE01083.1 399 Sequence 55999 from patent US 8586006
GI:68299767 RefSeq XP_005247160.1 399 PREDICTED: arylacetamide deacetylase isoform X1 [Homo sapiens]
GI:68299767 SwissProt P22760.5 399 RecName: Full=Arylacetamide deacetylase [Homo sapiens]

Related Sequences to LMP004662 proteins

Reference Database Accession Length Protein Name
GI:68299767 DBBJ BAF83317.1 399 unnamed protein product [Homo sapiens]
GI:68299767 GenBank EAW78791.1 399 arylacetamide deacetylase (esterase), isoform CRA_a [Homo sapiens]
GI:68299767 GenBank EAW78792.1 399 arylacetamide deacetylase (esterase), isoform CRA_a [Homo sapiens]
GI:68299767 RefSeq XP_001145851.1 399 PREDICTED: arylacetamide deacetylase [Pan troglodytes]
GI:68299767 RefSeq XP_003826504.1 399 PREDICTED: arylacetamide deacetylase [Pan paniscus]
GI:68299767 RefSeq XP_008950113.1 399 PREDICTED: arylacetamide deacetylase [Pan paniscus]