Gene/Proteome Database (LMPD)

LMPD ID
LMP004710
Gene ID
Species
Homo sapiens (Human)
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class V
Gene Symbol
Synonyms
GPI-MT-II; HPMRS1; PIG-V
Alternate Names
GPI mannosyltransferase 2; Ybr004c homolog; GPI mannosyltransferase II; dol-P-Man dependent GPI mannosyltransferase
Chromosome
1
Map Location
1p36.11
EC Number
2.4.1.-
Summary
This gene encodes a mannosyltransferase enzyme involved in the biosynthesis of glycosylphosphatidylinositol (GPI). GPI is a complex glycolipid that functions as a membrane anchor for many proteins and plays a role in multiple cellular processes including protein sorting and signal transduction. The encoded protein is localized to the endoplasmic reticulum and transfers the second mannose to the GPI backbone. Mutations in this gene are associated with hyperphosphatasia mental retardation syndrome. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]
Orthologs

Proteins

GPI mannosyltransferase 2
Refseq ID NP_060307
Protein GI 21361771
UniProt ID Q9NUD9
mRNA ID NM_017837
Length 493
RefSeq Status REVIEWED
MWPQDPSRKEVLRFAVSCRILTLMLQALFNAIIPDHHAEAFSPPRLAPSGFVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTELLRPLRGLLSLRSCLLISVASLNFLFFMLAAVALHDLGCLVLHCPHQSFYAALLFCLSPANVFLAAGYSEALFALLTFSAMGQLERGRVWTSVLLFAFATGVRSNGLVSVGFLMHSQCQGFFSSLTMLNPLRQLFKLMASLFLSVFTLGLPFALFQYYAYTQFCLPGSARPIPEPLVQLAVDKGYRIAEGNEPPWCFWDVPLIYSYIQDVYWNVGFLKYYELKQVPNFLLAAPVAILVAWATWTYVTTHPWLCLTLGLQRSKNNKTLEKPDLGFLSPQVFVYVVHAAVLLLFGGLCMHVQVLTRFLGSSTPIMYWFPAHLLQDQEPLLRSLKTVPWKPLAEDSPPGQKVPRNPIMGLLYHWKTCSPVTRYILGYFLTYWLLGLLLHCNFLPWT
GPI mannosyltransferase 2
Refseq ID NP_001189483
Protein GI 322309865
UniProt ID Q9NUD9
mRNA ID NM_001202554
Length 493
RefSeq Status REVIEWED
Protein sequence is identical to GI:21361771 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
phosphatidylinositol glycan anchor biosynthesis, class V
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:UniProtKB C endoplasmic reticulum membrane
GO:0016021 NAS:UniProtKB C integral component of membrane
GO:0000030 IMP:UniProtKB F mannosyltransferase activity
GO:0006501 TAS:Reactome P C-terminal protein lipidation
GO:0006506 IMP:UniProtKB P GPI anchor biosynthetic process
GO:0044267 TAS:Reactome P cellular protein metabolic process
GO:0097502 IMP:GOC P mannosylation
GO:0043687 TAS:Reactome P post-translational protein modification
GO:0016254 TAS:Reactome P preassembly of GPI anchor in ER membrane

KEGG Pathway Links

KEGG Pathway ID Description
hsa00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
hsa01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_952 Synthesis of glycosylphosphatidylinositol (GPI)

Domain Information

InterPro Annotations

Accession Description
IPR007315 GPI_Mannosyltransferase_2

UniProt Annotations

Entry Information

Gene Name
phosphatidylinositol glycan anchor biosynthesis, class V
Protein Entry
PIGV_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Disease Hyperphosphatasia with mental retardation syndrome 1 (HPMRS1) [MIM
Function Alpha-1,6-mannosyltransferase involved in glycosylphosphatidylinositol-anchor biosynthesis. Transfers the second mannose to the glycosylphosphatidylinositol during GPI precursor assembly. {ECO
Pathway Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis.
Ptm Not N-glycosylated.
Sequence Caution Sequence=CAI21625.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAI21626.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAI21627.1; Type=Erroneous gene model prediction; Evidence= ;
Similarity Belongs to the PIGV family.
Subcellular Location Endoplasmic reticulum membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP004710 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
21361771 RefSeq NP_060307 493 GPI mannosyltransferase 2

Identical Sequences to LMP004710 proteins

Reference Database Accession Length Protein Name
GI:21361771 GenBank EAX07790.1 493 phosphatidylinositol glycan, class V, isoform CRA_a [Homo sapiens]
GI:21361771 GenBank EAX07791.1 493 phosphatidylinositol glycan, class V, isoform CRA_a [Homo sapiens]
GI:21361771 GenBank EAX07792.1 493 phosphatidylinositol glycan, class V, isoform CRA_a [Homo sapiens]
GI:21361771 GenBank AIC51809.1 493 PIGV, partial [synthetic construct]
GI:21361771 RefSeq NP_001189483.1 493 GPI mannosyltransferase 2 [Homo sapiens]
GI:21361771 SwissProt Q9NUD9.1 493 RecName: Full=GPI mannosyltransferase 2; AltName: Full=GPI mannosyltransferase II; Short=GPI-MT-II; AltName: Full=Phosphatidylinositol-glycan biosynthesis class V protein; Short=PIG-V [Homo sapiens]

Related Sequences to LMP004710 proteins

Reference Database Accession Length Protein Name
GI:21361771 DBBJ BAA91196.1 493 unnamed protein product [Homo sapiens]
GI:21361771 EMBL CAH05337.1 493 unnamed protein product [Homo sapiens]
GI:21361771 EMBL CAH05376.1 493 unnamed protein product [Homo sapiens]
GI:21361771 RefSeq XP_003809480.1 493 PREDICTED: GPI mannosyltransferase 2 [Pan paniscus]
GI:21361771 RefSeq XP_008959902.1 493 PREDICTED: GPI mannosyltransferase 2 [Pan paniscus]
GI:21361771 RefSeq XP_008959903.1 493 PREDICTED: GPI mannosyltransferase 2 [Pan paniscus]