Gene/Proteome Database (LMPD)
LMPD ID
LMP004794
Gene ID
Species
Homo sapiens (Human)
Gene Name
glutathione peroxidase 6 (olfactory)
Gene Symbol
Synonyms
GPX5p; GPXP3; GPx-6; GSHPx-6; dJ1186N24; dJ1186N24.1
Alternate Names
glutathione peroxidase 6; glutathione peroxidase pseudogene 3
Chromosome
6
Map Location
6p22.1
EC Number
1.11.1.9
Summary
This gene product belongs to the glutathione peroxidase family, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Expression of this gene is restricted to embryos and adult olfactory epithelium. [provided by RefSeq, Jul 2008]
Orthologs
Proteins
| glutathione peroxidase 6 precursor | |
|---|---|
| Refseq ID | NP_874360 |
| Protein GI | 33186887 |
| UniProt ID | P59796 |
| mRNA ID | NM_182701 |
| Length | 221 |
| RefSeq Status | REVIEWED |
| MFQQFQASCLVLFFLVGFAQQTLKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFAGKHVLFVNVAAYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLKYVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDIRWNFEKFLVGPDGVPVMHWFHQAPVSTVKSDILEYLKQFNTH | |
| sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2197 peptide sequence: MFQQFQASCLVLFFLVGFA | |
Gene Information
Entrez Gene ID
Gene Name
glutathione peroxidase 6 (olfactory)
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
| GO:0004602 | IEA:UniProtKB-EC | F | glutathione peroxidase activity |
| GO:0006979 | IEA:InterPro | P | response to oxidative stress |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| hsa04918 | Thyroid hormone synthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glutathione peroxidase 6 (olfactory)
Protein Entry
GPX6_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O. |
| Similarity | Belongs to the glutathione peroxidase family. |
| Subcellular Location | Secreted . |
| Tissue Specificity | Expressed in olfactory epithelium and embryos. |
| Web Resource | Name=NIEHS-SNPs; URL="http://egp.gs.washington.edu/data/gpx6/"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004794 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 33186887 | RefSeq | NP_874360 | 221 | glutathione peroxidase 6 precursor |
Identical Sequences to LMP004794 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:33186887 | GenBank | AAP85543.1 | 221 | glutathione peroxidase 6 [Homo sapiens] |
| GI:33186887 | SwissProt | P59796.2 | 221 | RecName: Full=Glutathione peroxidase 6; Short=GPx-6; Short=GSHPx-6; Flags: Precursor [Homo sapiens] |
Related Sequences to LMP004794 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:33186887 | GenBank | AAY68223.1 | 221 | glutathione peroxidase 6 (olfactory) [Homo sapiens] |
| GI:33186887 | RefSeq | NP_001139297.1 | 221 | glutathione peroxidase 6 precursor [Pan troglodytes] |
| GI:33186887 | RefSeq | XP_003776830.1 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Pongo abelii] |
| GI:33186887 | RefSeq | XP_003829753.1 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Pan paniscus] |
| GI:33186887 | RefSeq | XP_003897298.1 | 221 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Papio anubis] |
| GI:33186887 | RefSeq | XP_007971535.1 | 257 | PREDICTED: LOW QUALITY PROTEIN: glutathione peroxidase 6 [Chlorocebus sabaeus] |