Gene/Proteome Database (LMPD)

LMPD ID
LMP004813
Gene ID
Species
Homo sapiens (Human)
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Synonyms
CXCLG16; SR-PSOX; SRPSOX
Alternate Names
C-X-C motif chemokine 16; CXC chemokine ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein
Chromosome
17
Map Location
17p13

Proteins

C-X-C motif chemokine 16 precursor
Refseq ID NP_071342
Protein GI 154816176
UniProt ID Q9H2A7
mRNA ID NM_022059
Length 273
RefSeq Status VALIDATED
MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT
sig_peptide: 1..48 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 5132 peptide sequence: MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNG sig_peptide: 1..48 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 5132 peptide sequence: MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNG
C-X-C motif chemokine 16 precursor
Refseq ID NP_001094282
Protein GI 154816178
UniProt ID Q9H2A7
mRNA ID NM_001100812
Length 273
RefSeq Status VALIDATED
Protein sequence is identical to GI:154816176 (mRNA isoform)

Gene Information

Entrez Gene ID
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 NAS:UniProtKB C extracellular region
GO:0005615 IDA:BHF-UCL C extracellular space
GO:0016021 NAS:UniProtKB C integral component of membrane
GO:0016020 TAS:UniProtKB C membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0008009 ISS:UniProtKB F chemokine activity
GO:0005041 ISS:UniProtKB F low-density lipoprotein receptor activity
GO:0005102 NAS:UniProtKB F receptor binding
GO:0005044 TAS:UniProtKB F scavenger receptor activity
GO:0006935 NAS:UniProtKB P chemotaxis
GO:0048247 NAS:UniProtKB P lymphocyte chemotaxis
GO:0030307 IMP:BHF-UCL P positive regulation of cell growth
GO:0030335 IMP:BHF-UCL P positive regulation of cell migration
GO:0006898 NAS:UniProtKB P receptor-mediated endocytosis
GO:0034097 IDA:BHF-UCL P response to cytokine
GO:0034341 IDA:BHF-UCL P response to interferon-gamma
GO:0034612 IDA:BHF-UCL P response to tumor necrosis factor

KEGG Pathway Links

KEGG Pathway ID Description
hsa04062 Chemokine signaling pathway
hsa04060 Cytokine-cytokine receptor interaction

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_15344 Chemokine receptors bind chemokines
REACT_19231 G alpha (i) signalling events

Domain Information

InterPro Annotations

Accession Description
IPR026296 CXC chemokine 16

UniProt Annotations

Entry Information

Gene Name
chemokine (C-X-C motif) ligand 16
Protein Entry
CXL16_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Function Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo.
Ptm Glycosylated.
Sequence Caution Sequence=AAG34365.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH17588.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH44930.1; Type=Erroneous initiation; Evidence= ; Sequence=ABK41925.1; Type=Erroneous initiation; Evidence= ; Sequence=BAB55078.1; Type=Erroneous initiation; Evidence= ; Sequence=BAF84803.1; Type=Erroneous initiation; Evidence= ; Sequence=BAG37507.1; Type=Erroneous initiation; Evidence= ;
Similarity Belongs to the intercrine alpha (chemokine CxC) family.
Subcellular Location Cell membrane ; Single-pass type I membrane protein . Secreted. Note=Also exists as a soluble form.
Tissue Specificity Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
Web Resource Name=Wikipedia; Note=CXCL16 entry; URL="http://en.wikipedia.org/wiki/CXCL16";

Identical and Related Proteins

Unique RefSeq proteins for LMP004813 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
154816176 RefSeq NP_071342 273 C-X-C motif chemokine 16 precursor

Identical Sequences to LMP004813 proteins

Reference Database Accession Length Protein Name
GI:154816176 EMBL CDM22050.1 273 unnamed protein product [Homo sapiens]
GI:154816176 EMBL CDM22051.1 273 unnamed protein product [Homo sapiens]
GI:154816176 GenBank AFO18217.1 273 Sequence 31 from patent US 8206947
GI:154816176 GenBank AGX48730.1 273 Sequence 44 from patent US 8541564
GI:154816176 GenBank AHD29154.1 273 Sequence 18 from patent US 8563476
GI:154816176 GenBank AIC56928.1 273 CXCL16, partial [synthetic construct]

Related Sequences to LMP004813 proteins

Reference Database Accession Length Protein Name
GI:154816176 GenBank EAW90416.1 273 chemokine (C-X-C motif) ligand 16 [Homo sapiens]
GI:154816176 GenBank ACM84443.1 408 Sequence 9941 from patent US 6812339
GI:154816176 GenBank ACP57369.1 273 Sequence 1498 from patent US 7482117
GI:154816176 GenBank ADS30966.1 273 Sequence 1498 from patent US 7781168
GI:154816176 GenBank AFO05740.1 273 Sequence 378 from patent US 8216786
GI:154816176 GenBank AHD69781.1 273 Sequence 1370 from patent US 8586006