Gene/Proteome Database (LMPD)
LMPD ID
LMP004813
Gene ID
Species
Homo sapiens (Human)
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Synonyms
CXCLG16; SR-PSOX; SRPSOX
Alternate Names
C-X-C motif chemokine 16; CXC chemokine ligand 16; small-inducible cytokine B16; transmembrane chemokine CXCL16; scavenger receptor for phosphatidylserine and oxidized low density lipoprotein
Chromosome
17
Map Location
17p13
Proteins
C-X-C motif chemokine 16 precursor | |
---|---|
Refseq ID | NP_071342 |
Protein GI | 154816176 |
UniProt ID | Q9H2A7 |
mRNA ID | NM_022059 |
Length | 273 |
RefSeq Status | VALIDATED |
MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRKHLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTSPPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLAAGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPVAPDSNT | |
sig_peptide: 1..48 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 5132 peptide sequence: MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNG sig_peptide: 1..48 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 5132 peptide sequence: MSGSQSEVAPSPQSPRSPEMGRDLRPGSRVLLLLLLLLLVYLTQPGNG |
C-X-C motif chemokine 16 precursor | |
---|---|
Refseq ID | NP_001094282 |
Protein GI | 154816178 |
UniProt ID | Q9H2A7 |
mRNA ID | NM_001100812 |
Length | 273 |
RefSeq Status | VALIDATED |
Protein sequence is identical to GI:154816176 (mRNA isoform) |
Gene Information
Entrez Gene ID
Gene Name
chemokine (C-X-C motif) ligand 16
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | NAS:UniProtKB | C | extracellular region |
GO:0005615 | IDA:BHF-UCL | C | extracellular space |
GO:0016021 | NAS:UniProtKB | C | integral component of membrane |
GO:0016020 | TAS:UniProtKB | C | membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0008009 | ISS:UniProtKB | F | chemokine activity |
GO:0005041 | ISS:UniProtKB | F | low-density lipoprotein receptor activity |
GO:0005102 | NAS:UniProtKB | F | receptor binding |
GO:0005044 | TAS:UniProtKB | F | scavenger receptor activity |
GO:0006935 | NAS:UniProtKB | P | chemotaxis |
GO:0048247 | NAS:UniProtKB | P | lymphocyte chemotaxis |
GO:0030307 | IMP:BHF-UCL | P | positive regulation of cell growth |
GO:0030335 | IMP:BHF-UCL | P | positive regulation of cell migration |
GO:0006898 | NAS:UniProtKB | P | receptor-mediated endocytosis |
GO:0034097 | IDA:BHF-UCL | P | response to cytokine |
GO:0034341 | IDA:BHF-UCL | P | response to interferon-gamma |
GO:0034612 | IDA:BHF-UCL | P | response to tumor necrosis factor |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
hsa04062 | Chemokine signaling pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
REACT_15344 | Chemokine receptors bind chemokines |
REACT_19231 | G alpha (i) signalling events |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR026296 | CXC chemokine 16 |
UniProt Annotations
Entry Information
Gene Name
chemokine (C-X-C motif) ligand 16
Protein Entry
CXL16_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Function | Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response. Induces calcium mobilization. Binds to CXCR6/Bonzo. |
Ptm | Glycosylated. |
Sequence Caution | Sequence=AAG34365.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH17588.1; Type=Erroneous initiation; Evidence= ; Sequence=AAH44930.1; Type=Erroneous initiation; Evidence= ; Sequence=ABK41925.1; Type=Erroneous initiation; Evidence= ; Sequence=BAB55078.1; Type=Erroneous initiation; Evidence= ; Sequence=BAF84803.1; Type=Erroneous initiation; Evidence= ; Sequence=BAG37507.1; Type=Erroneous initiation; Evidence= ; |
Similarity | Belongs to the intercrine alpha (chemokine CxC) family. |
Subcellular Location | Cell membrane ; Single-pass type I membrane protein . Secreted. Note=Also exists as a soluble form. |
Tissue Specificity | Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow. |
Web Resource | Name=Wikipedia; Note=CXCL16 entry; URL="http://en.wikipedia.org/wiki/CXCL16"; |
Identical and Related Proteins
Unique RefSeq proteins for LMP004813 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
154816176 | RefSeq | NP_071342 | 273 | C-X-C motif chemokine 16 precursor |
Identical Sequences to LMP004813 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:154816176 | EMBL | CDM22050.1 | 273 | unnamed protein product [Homo sapiens] |
GI:154816176 | EMBL | CDM22051.1 | 273 | unnamed protein product [Homo sapiens] |
GI:154816176 | GenBank | AFO18217.1 | 273 | Sequence 31 from patent US 8206947 |
GI:154816176 | GenBank | AGX48730.1 | 273 | Sequence 44 from patent US 8541564 |
GI:154816176 | GenBank | AHD29154.1 | 273 | Sequence 18 from patent US 8563476 |
GI:154816176 | GenBank | AIC56928.1 | 273 | CXCL16, partial [synthetic construct] |
Related Sequences to LMP004813 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:154816176 | GenBank | EAW90416.1 | 273 | chemokine (C-X-C motif) ligand 16 [Homo sapiens] |
GI:154816176 | GenBank | ACM84443.1 | 408 | Sequence 9941 from patent US 6812339 |
GI:154816176 | GenBank | ACP57369.1 | 273 | Sequence 1498 from patent US 7482117 |
GI:154816176 | GenBank | ADS30966.1 | 273 | Sequence 1498 from patent US 7781168 |
GI:154816176 | GenBank | AFO05740.1 | 273 | Sequence 378 from patent US 8216786 |
GI:154816176 | GenBank | AHD69781.1 | 273 | Sequence 1370 from patent US 8586006 |