Gene/Proteome Database (LMPD)
LMPD ID
LMP004839
Gene ID
Species
Mus musculus (Mouse)
Gene Name
succinate-CoA ligase, GDP-forming, alpha subunit
Gene Symbol
Synonyms
1500000I01Rik; Sucla1
Alternate Names
succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; SCS-alpha; succinyl-CoA synthetase subunit alpha; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial
Chromosome
6
Map Location
6|6 C3
EC Number
6.2.1.4
Proteins
succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor | |
---|---|
Refseq ID | NP_063932 |
Protein GI | 255958286 |
UniProt ID | Q9WUM5 |
mRNA ID | NM_019879 |
Length | 346 |
RefSeq Status | VALIDATED |
MTATVVAAAATATMVSSSSGLAAARLLSRTFLLQQNGIRHGSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHRLTRQGTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGIILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML | |
transit_peptide: 1..40 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (By similarity); propagated from UniProtKB/Swiss-Prot (Q9WUM5.4) calculated_mol_wt: 4075 peptide sequence: MTATVVAAAATATMVSSSSGLAAARLLSRTFLLQQNGIRH mat_peptide: 41..346 product: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9WUM5.4) calculated_mol_wt: 32098 peptide sequence: GSYTASRKHIYIDKNTKIICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGQKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHRLTRQGTTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTDFIDCLEVFLNDPATEGIILIGEIGGHAEENAAAFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVVSMSPAQLGTTIYKEFEKRKML |
Gene Information
Entrez Gene ID
Gene Name
succinate-CoA ligase, GDP-forming, alpha subunit
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
GO:0005743 | IDA:MGI | C | mitochondrial inner membrane |
GO:0005739 | IDA:MGI | C | mitochondrion |
GO:0045244 | IEA:Ensembl | C | succinate-CoA ligase complex (GDP-forming) |
GO:0003878 | IEA:InterPro | F | ATP citrate synthase activity |
GO:0019003 | IEA:Ensembl | F | GDP binding |
GO:0005525 | IEA:UniProtKB-KW | F | GTP binding |
GO:0048037 | IEA:InterPro | F | cofactor binding |
GO:0044822 | IEA:Ensembl | F | poly(A) RNA binding |
GO:0004775 | IEA:UniProtKB-EC | F | succinate-CoA ligase (ADP-forming) activity |
GO:0004776 | IEA:UniProtKB-EC | F | succinate-CoA ligase (GDP-forming) activity |
GO:0006105 | IEA:Ensembl | P | succinate metabolic process |
GO:0006104 | IEA:Ensembl | P | succinyl-CoA metabolic process |
GO:0006099 | IEA:UniProtKB-UniPathway | P | tricarboxylic acid cycle |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
succinate-CoA ligase, GDP-forming, alpha subunit
Protein Entry
SUCA_MOUSE
UniProt ID
Species
Mouse
Comments
Comment Type | Description |
---|---|
Catalytic Activity | ATP + succinate + CoA = ADP + phosphate + succinyl-CoA. |
Catalytic Activity | GTP + succinate + CoA = GDP + phosphate + succinyl-CoA. |
Function | Catalyzes the ATP- or GTP-dependent ligation of succinate and CoA to form succinyl-CoA. The nature of the beta subunit determines the nucleotide specificity (By similarity). {ECO:0000250}. |
Pathway | Carbohydrate metabolism; tricarboxylic acid cycle. |
Sequence Caution | Sequence=AAD33927.2; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=AAH11087.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAB22331.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAB23804.1; Type=Erroneous initiation; Evidence={ECO:0000305}; Sequence=BAC40634.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
Similarity | Belongs to the succinate/malate CoA ligase alpha subunit family. {ECO:0000305}. |
Subcellular Location | Mitochondrion {ECO:0000250}. |
Subunit | Heterodimer of an alpha and a beta subunit. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004839 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
255958286 | RefSeq | NP_063932 | 346 | succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor |
Identical Sequences to LMP004839 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:255958286 | SwissProt | Q9WUM5.4 | 346 | RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha; Flags: Precursor [Mus musculus] |
Related Sequences to LMP004839 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:255958286 | RefSeq | XP_004437258.1 | 346 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial [Ceratotherium simum simum] |
GI:255958286 | RefSeq | XP_005364778.1 | 346 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial [Microtus ochrogaster] |
GI:255958286 | RefSeq | XP_005655282.1 | 346 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1 [Sus scrofa] |
GI:255958286 | RefSeq | XP_007968242.1 | 415 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial [Chlorocebus sabaeus] |
GI:255958286 | RefSeq | XP_008589148.1 | 346 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1 [Galeopterus variegatus] |
GI:255958286 | RefSeq | XP_008698280.1 | 346 | PREDICTED: succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial isoform X1 [Ursus maritimus] |