Gene/Proteome Database (LMPD)
LMPD ID
LMP004856
Gene ID
Species
Homo sapiens (Human)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Synonyms
DIPP; DIPP-1; DIPP1
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 1; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3', "diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1
Chromosome
6
Map Location
6p21.2
EC Number
3.6.1.52
Summary
NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]
Orthologs
Proteins
| diphosphoinositol polyphosphate phosphohydrolase 1 | |
|---|---|
| Refseq ID | NP_006694 |
| Protein GI | 5729804 |
| UniProt ID | O95989 |
| mRNA ID | NM_006703 |
| Length | 172 |
| RefSeq Status | VALIDATED |
| MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR | |
Gene Information
Entrez Gene ID
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | TAS:Reactome | C | cytosol |
| GO:0070062 | IDA:UniProt | C | extracellular vesicular exosome |
| GO:0008486 | IDA:UniProtKB | F | diphosphoinositol-polyphosphate diphosphatase activity |
| GO:0052840 | IEA:UniProtKB-EC | F | inositol diphosphate tetrakisphosphate diphosphatase activity |
| GO:0052846 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity |
| GO:0052847 | IEA:UniProtKB-EC | F | inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052843 | IEA:UniProtKB-EC | F | inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052848 | IEA:UniProtKB-EC | F | inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity |
| GO:0052844 | IEA:UniProtKB-EC | F | inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity |
| GO:0052845 | IEA:UniProtKB-EC | F | inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity |
| GO:0000287 | IDA:UniProtKB | F | magnesium ion binding |
| GO:0007267 | TAS:ProtInc | P | cell-cell signaling |
| GO:0015961 | TAS:ProtInc | P | diadenosine polyphosphate catabolic process |
| GO:0071544 | IDA:UniProtKB | P | diphosphoinositol polyphosphate catabolic process |
| GO:0043647 | TAS:Reactome | P | inositol phosphate metabolic process |
| GO:0044281 | TAS:Reactome | P | small molecule metabolic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| REACT_150154 | Inositol phosphate metabolism |
| REACT_111217 | Metabolism |
| REACT_150188 | Synthesis of pyrophosphates in the cytosol |
Domain Information
UniProt Annotations
Entry Information
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
NUDT3_HUMAN
UniProt ID
Species
Human
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=5.9 uM for Ap6A {ECO |
| Catalytic Activity | Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. {ECO |
| Cofactor | Name=Mg(2+); Xref=ChEBI |
| Enzyme Regulation | Inhibited by fluoride and InsP6. |
| Function | Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5- phosphoribose 1-diphosphate. |
| Similarity | Belongs to the Nudix hydrolase family. DIPP subfamily. |
| Similarity | Contains 1 nudix hydrolase domain. |
| Subcellular Location | Cytoplasm . |
| Subunit | Monomer. |
| Tissue Specificity | Widely expressed. Expressed at higher level in brain, heart, pancreas and liver. Also expressed in placenta, lung and kidney. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004856 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 5729804 | RefSeq | NP_006694 | 172 | diphosphoinositol polyphosphate phosphohydrolase 1 |
Identical Sequences to LMP004856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5729804 | GenBank | AIC50829.1 | 172 | NUDT3, partial [synthetic construct] |
| GI:5729804 | RefSeq | XP_005553319.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca fascicularis] |
| GI:5729804 | RefSeq | XP_007971083.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Chlorocebus sabaeus] |
| GI:5729804 | RefSeq | XP_008958861.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Pan paniscus] |
| GI:5729804 | RefSeq | XP_010356372.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana] |
| GI:5729804 | RefSeq | XP_010356373.1 | 172 | PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana] |
Related Sequences to LMP004856 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:5729804 | GenBank | AAV38785.1 | 173 | nudix (nucleoside diphosphate linked moiety X)-type motif 3, partial [synthetic construct] |
| GI:5729804 | GenBank | AAV38786.1 | 173 | nudix (nucleoside diphosphate linked moiety X)-type motif 3, partial [synthetic construct] |
| GI:5729804 | GenBank | AAX29314.1 | 173 | nudix-type motif 3, partial [synthetic construct] |
| GI:5729804 | GenBank | AAX36804.1 | 173 | nudix-type motif 3, partial [synthetic construct] |
| GI:5729804 | GenBank | AAX43008.1 | 173 | nudix-type motif 3, partial [synthetic construct] |
| GI:5729804 | GenBank | AAX43009.1 | 173 | nudix-type motif 3, partial [synthetic construct] |