Gene/Proteome Database (LMPD)

LMPD ID
LMP004856
Gene ID
11165
Species
Homo sapiens (Human)
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
NUDT3
Synonyms
DIPP; DIPP-1; DIPP1
Alternate Names
diphosphoinositol polyphosphate phosphohydrolase 1; nudix motif 3; nucleoside diphosphate-linked moiety X motif 3', "diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase 1
Chromosome
6
Map Location
6p21.2
EC Number
3.6.1.52
Summary
NUDT3 belongs to the MutT, or Nudix, protein family. Nudix proteins act as homeostatic checkpoints at important stages in nucleoside phosphate metabolic pathways, guarding against elevated levels of potentially dangerous intermediates, like 8-oxo-dGTP, which promotes AT-to-CG transversions (Safrany et al., 1998 [PubMed 9822604]).[supplied by OMIM, Feb 2011]
Orthologs
View orthologs and multiple alignments for NUDT3

Proteins

diphosphoinositol polyphosphate phosphohydrolase 1
Refseq ID NP_006694
Protein GI 5729804
UniProt ID O95989
mRNA ID NM_006703
Length 172
RefSeq Status VALIDATED
MMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR

Gene Information

Entrez Gene ID
11165
Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Gene Symbol
NUDT3
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 TAS:Reactome C cytosol
GO:0070062 IDA:UniProt C extracellular vesicular exosome
GO:0008486 IDA:UniProtKB F diphosphoinositol-polyphosphate diphosphatase activity
GO:0052846 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 1-diphosphatase activity
GO:0052847 IEA:UniProtKB-EC F inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052843 IEA:UniProtKB-EC F inositol-1-diphosphate-2,3,4,5,6-pentakisphosphate diphosphatase activity
GO:0052848 IEA:UniProtKB-EC F inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity
GO:0052844 IEA:UniProtKB-EC F inositol-3-diphosphate-1,2,4,5,6-pentakisphosphate diphosphatase activity
GO:0052845 IEA:UniProtKB-EC F inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity
GO:0052840 IEA:UniProtKB-EC F inositol diphosphate tetrakisphosphate diphosphatase activity
GO:0000287 IDA:UniProtKB F magnesium ion binding
GO:0007267 TAS:ProtInc P cell-cell signaling
GO:0015961 TAS:ProtInc P diadenosine polyphosphate catabolic process
GO:0071544 IDA:UniProtKB P diphosphoinositol polyphosphate catabolic process
GO:0043647 TAS:Reactome P inositol phosphate metabolic process
GO:0044281 TAS:Reactome P small molecule metabolic process

REACTOME Pathway Links

REACTOME Pathway ID Description
REACT_150154 Inositol phosphate metabolism
REACT_111217 Metabolism
REACT_150188 Synthesis of pyrophosphates in the cytosol

Domain Information

InterPro Annotations

Accession Description
IPR020084 NUDIX hydrolase, conserved site
IPR000086 NUDIX hydrolase domain
IPR015797 NUDIX hydrolase domain-like

UniProt Annotations

Entry Information

Gene Name
nudix (nucleoside diphosphate linked moiety X)-type motif 3
Protein Entry
NUDT3_HUMAN
UniProt ID
O95989
Species
Human

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=5.9 uM for Ap6A {ECO
Catalytic Activity Diphospho-myo-inositol polyphosphate + H(2)O = myo-inositol polyphosphate + phosphate. {ECO
Cofactor Name=Mg(2+); Xref=ChEBI
Enzyme Regulation Inhibited by fluoride and InsP6.
Function Cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate), suggesting that it may play a role in signal transduction. InsP6 (inositol hexakisphophate) is not a substrate. Acts as a negative regulator of the ERK1/2 pathway. Also able to catalyze the hydrolysis of dinucleoside oligophosphates, with Ap6A and Ap5A being the preferred substrates. The major reaction products are ADP and p4a from Ap6A and ADP and ATP from Ap5A. Also able to hydrolyze 5- phosphoribose 1-diphosphate.
Similarity Belongs to the Nudix hydrolase family. DIPP subfamily.
Similarity Contains 1 nudix hydrolase domain.
Subcellular Location Cytoplasm .
Subunit Monomer.
Tissue Specificity Widely expressed. Expressed at higher level in brain, heart, pancreas and liver. Also expressed in placenta, lung and kidney.

Identical and Related Proteins

Unique RefSeq proteins for LMP004856 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
5729804 RefSeq NP_006694 172 diphosphoinositol polyphosphate phosphohydrolase 1

Identical Sequences to LMP004856 proteins

Reference Database Accession Length Protein Name
GI:5729804 GenBank AIC50829.1 172 NUDT3, partial [synthetic construct]
GI:5729804 RefSeq XP_005553319.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Macaca fascicularis]
GI:5729804 RefSeq XP_007971083.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Chlorocebus sabaeus]
GI:5729804 RefSeq XP_008958861.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Pan paniscus]
GI:5729804 RefSeq XP_010356372.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana]
GI:5729804 RefSeq XP_010356373.1 172 PREDICTED: diphosphoinositol polyphosphate phosphohydrolase 1 [Rhinopithecus roxellana]

Related Sequences to LMP004856 proteins

Reference Database Accession Length Protein Name
GI:5729804 GenBank AAV38785.1 173 nudix (nucleoside diphosphate linked moiety X)-type motif 3, partial [synthetic construct]
GI:5729804 GenBank AAV38786.1 173 nudix (nucleoside diphosphate linked moiety X)-type motif 3, partial [synthetic construct]
GI:5729804 GenBank AAX29314.1 173 nudix-type motif 3, partial [synthetic construct]
GI:5729804 GenBank AAX36804.1 173 nudix-type motif 3, partial [synthetic construct]
GI:5729804 GenBank AAX43008.1 173 nudix-type motif 3, partial [synthetic construct]
GI:5729804 GenBank AAX43009.1 173 nudix-type motif 3, partial [synthetic construct]