Gene/Proteome Database (LMPD)

LMPD ID
LMP004857
Gene ID
Species
Homo sapiens (Human)
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Synonyms
PDCR; SDR17C1
Alternate Names
peroxisomal 2,4-dienoyl-CoA reductase; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1
Chromosome
16
Map Location
16p13.3
EC Number
1.3.1.34

Proteins

peroxisomal 2,4-dienoyl-CoA reductase
Refseq ID NP_065715
Protein GI 10190704
UniProt ID Q9NUI1
mRNA ID NM_020664
Length 292
RefSeq Status VALIDATED
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL

Gene Information

Entrez Gene ID
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005778 IEA:Ensembl C peroxisomal membrane
GO:0008670 IDA:UniProtKB F 2,4-dienoyl-CoA reductase (NADPH) activity
GO:0005102 IPI:UniProtKB F receptor binding
GO:0019166 IDA:UniProtKB F trans-2-enoyl-CoA reductase (NADPH) activity
GO:0006636 IDA:UniProtKB P unsaturated fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa04146 Peroxisome
ko04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR

UniProt Annotations

Entry Information

Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Protein Entry
DECR2_HUMAN
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NUI1-1; Sequence=Displayed; Name=2; IsoId=Q9NUI1-2; Sequence=VSP_013630, VSP_013631, VSP_013632; Note=No experimental confirmation available.; Name=3; IsoId=Q9NUI1-3; Sequence=VSP_013629; Note=No experimental confirmation available.;
Biophysicochemical Properties Kinetic parameters: KM=59 uM for 2,4-hexadienoyl-CoA {ECO
Catalytic Activity Trans-2,3-didehydroacyl-CoA + NADP(+) = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH.
Function Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19- docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.
Subcellular Location Peroxisome .
Subunit Monomer, dimer and oligomer.

Identical and Related Proteins

Unique RefSeq proteins for LMP004857 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
10190704 RefSeq NP_065715 292 peroxisomal 2,4-dienoyl-CoA reductase

Identical Sequences to LMP004857 proteins

Reference Database Accession Length Protein Name
GI:10190704 EMBL CAC60355.1 292 unnamed protein product [Homo sapiens]
GI:10190704 GenBank AAM57342.1 292 Sequence 58 from patent US 6372431
GI:10190704 GenBank EAW85812.1 292 2,4-dienoyl CoA reductase 2, peroxisomal, isoform CRA_b [Homo sapiens]
GI:10190704 GenBank ADQ31635.1 292 2,4-dienoyl CoA reductase 2, peroxisomal, partial [synthetic construct]
GI:10190704 GenBank AIC51101.1 292 DECR2, partial [synthetic construct]
GI:10190704 SwissProt Q9NUI1.1 292 RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; Short=pDCR; AltName: Full=2,4-dienoyl-CoA reductase 2 [Homo sapiens]

Related Sequences to LMP004857 proteins

Reference Database Accession Length Protein Name
GI:10190704 GenBank JAA05041.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes]
GI:10190704 GenBank JAA12771.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes]
GI:10190704 GenBank JAA32471.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes]
GI:10190704 GenBank JAA38593.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes]
GI:10190704 RefSeq NP_001125423.1 292 peroxisomal 2,4-dienoyl-CoA reductase [Pongo abelii]
GI:10190704 SwissProt Q5RBV3.1 292 RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2 [Pongo abelii]