Gene/Proteome Database (LMPD)
LMPD ID
LMP004857
Gene ID
Species
Homo sapiens (Human)
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Synonyms
PDCR; SDR17C1
Alternate Names
peroxisomal 2,4-dienoyl-CoA reductase; 2,4-dienoyl-CoA reductase 2; short chain dehydrogenase/reductase family 17C, member 1
Chromosome
16
Map Location
16p13.3
EC Number
1.3.1.34
Proteins
peroxisomal 2,4-dienoyl-CoA reductase | |
---|---|
Refseq ID | NP_065715 |
Protein GI | 10190704 |
UniProt ID | Q9NUI1 |
mRNA ID | NM_020664 |
Length | 292 |
RefSeq Status | VALIDATED |
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL |
Gene Information
Entrez Gene ID
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Species
Homo sapiens
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005778 | IEA:Ensembl | C | peroxisomal membrane |
GO:0008670 | IDA:UniProtKB | F | 2,4-dienoyl-CoA reductase (NADPH) activity |
GO:0005102 | IPI:UniProtKB | F | receptor binding |
GO:0019166 | IDA:UniProtKB | F | trans-2-enoyl-CoA reductase (NADPH) activity |
GO:0006636 | IDA:UniProtKB | P | unsaturated fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Protein Entry
DECR2_HUMAN
UniProt ID
Species
Human
Comments
Comment Type | Description |
---|---|
Alternative Products | Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q9NUI1-1; Sequence=Displayed; Name=2; IsoId=Q9NUI1-2; Sequence=VSP_013630, VSP_013631, VSP_013632; Note=No experimental confirmation available.; Name=3; IsoId=Q9NUI1-3; Sequence=VSP_013629; Note=No experimental confirmation available.; |
Biophysicochemical Properties | Kinetic parameters: KM=59 uM for 2,4-hexadienoyl-CoA {ECO |
Catalytic Activity | Trans-2,3-didehydroacyl-CoA + NADP(+) = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH. |
Function | Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19- docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid. |
Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily. |
Subcellular Location | Peroxisome . |
Subunit | Monomer, dimer and oligomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP004857 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
10190704 | RefSeq | NP_065715 | 292 | peroxisomal 2,4-dienoyl-CoA reductase |
Identical Sequences to LMP004857 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:10190704 | EMBL | CAC60355.1 | 292 | unnamed protein product [Homo sapiens] |
GI:10190704 | GenBank | AAM57342.1 | 292 | Sequence 58 from patent US 6372431 |
GI:10190704 | GenBank | EAW85812.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal, isoform CRA_b [Homo sapiens] |
GI:10190704 | GenBank | ADQ31635.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal, partial [synthetic construct] |
GI:10190704 | GenBank | AIC51101.1 | 292 | DECR2, partial [synthetic construct] |
GI:10190704 | SwissProt | Q9NUI1.1 | 292 | RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; Short=pDCR; AltName: Full=2,4-dienoyl-CoA reductase 2 [Homo sapiens] |
Related Sequences to LMP004857 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:10190704 | GenBank | JAA05041.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes] |
GI:10190704 | GenBank | JAA12771.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes] |
GI:10190704 | GenBank | JAA32471.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes] |
GI:10190704 | GenBank | JAA38593.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Pan troglodytes] |
GI:10190704 | RefSeq | NP_001125423.1 | 292 | peroxisomal 2,4-dienoyl-CoA reductase [Pongo abelii] |
GI:10190704 | SwissProt | Q5RBV3.1 | 292 | RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2 [Pongo abelii] |