Gene/Proteome Database (LMPD)
Proteins
| V-type proton ATPase 16 kDa proteolipid subunit | |
|---|---|
| Refseq ID | NP_033859 |
| Protein GI | 6753144 |
| UniProt ID | P63082 |
| mRNA ID | NM_009729 |
| Length | 155 |
| RefSeq Status | PROVISIONAL |
| MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK | |
Gene Information
Entrez Gene ID
Gene Name
ATPase, H+ transporting, lysosomal V0 subunit C
Gene Symbol
Species
Mus musculus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0070062 | IEA:Ensembl | C | extracellular vesicular exosome |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005765 | IEA:Ensembl | C | lysosomal membrane |
| GO:0033179 | IEA:InterPro | C | proton-transporting V-type ATPase, V0 domain |
| GO:0016471 | TAS:MGI | C | vacuolar proton-transporting V-type ATPase complex |
| GO:0008553 | ISA:MGI | F | hydrogen-exporting ATPase activity, phosphorylative mechanism |
| GO:0015991 | IEA:InterPro | P | ATP hydrolysis coupled proton transport |
| GO:0007042 | TAS:MGI | P | lysosomal lumen acidification |
| GO:0030177 | IEA:Ensembl | P | positive regulation of Wnt signaling pathway |
| GO:0007035 | TAS:MGI | P | vacuolar acidification |
Domain Information
UniProt Annotations
Entry Information
Gene Name
ATPase, H+ transporting, lysosomal V0 subunit C
Protein Entry
VATL_MOUSE
UniProt ID
Species
Mouse
Identical and Related Proteins
Unique RefSeq proteins for LMP004865 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6753144 | RefSeq | NP_033859 | 155 | V-type proton ATPase 16 kDa proteolipid subunit |
Identical Sequences to LMP004865 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6753144 | GenBank | AAH83129.2 | 155 | ATPase, H+ transporting, lysosomal V0 subunit C [Mus musculus] |
| GI:6753144 | GenBank | AAH99475.2 | 155 | ATPase, H+ transporting, lysosomal V0 subunit C [Mus musculus] |
| GI:6753144 | GenBank | EDL13651.1 | 155 | mCG121835 [Mus musculus] |
| GI:6753144 | GenBank | EDL22293.1 | 155 | mCG12839 [Mus musculus] |
| GI:6753144 | GenBank | EDM03810.1 | 155 | ATPase, H transporting, lysosomal V0 subunit c, isoform CRA_b [Rattus norvegicus] |
| GI:6753144 | RefSeq | XP_006245960.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform X1 [Rattus norvegicus] |
Related Sequences to LMP004865 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6753144 | DBBJ | BAC25834.1 | 155 | unnamed protein product [Mus musculus] |
| GI:6753144 | DBBJ | BAE26942.1 | 155 | unnamed protein product [Mus musculus] |
| GI:6753144 | GenBank | AAH50939.1 | 188 | Atp6v0c protein, partial [Mus musculus] |
| GI:6753144 | GenBank | EDM03811.1 | 165 | ATPase, H transporting, lysosomal V0 subunit c, isoform CRA_c [Rattus norvegicus] |
| GI:6753144 | RefSeq | XP_005081689.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Mesocricetus auratus] |
| GI:6753144 | RefSeq | XP_005349252.1 | 155 | PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Microtus ochrogaster] |