Gene/Proteome Database (LMPD)

LMPD ID
LMP004865
Gene ID
Species
Mus musculus (Mouse)
Gene Name
ATPase, H+ transporting, lysosomal V0 subunit C
Gene Symbol
Synonyms
Atp6c; Atp6c2; Atp6l; Atpl; Atpl-rs1; PL16; VATL; Vma3
Chromosome
17
Map Location
17 A3.3|17

Proteins

V-type proton ATPase 16 kDa proteolipid subunit
Refseq ID NP_033859
Protein GI 6753144
UniProt ID P63082
mRNA ID NM_009729
Length 155
RefSeq Status PROVISIONAL
MADIKNNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

Gene Information

Entrez Gene ID
Gene Name
ATPase, H+ transporting, lysosomal V0 subunit C
Gene Symbol
Species
Mus musculus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005765 IEA:Ensembl C lysosomal membrane
GO:0033179 IEA:InterPro C proton-transporting V-type ATPase, V0 domain
GO:0016471 TAS:MGI C vacuolar proton-transporting V-type ATPase complex
GO:0008553 ISA:MGI F hydrogen-exporting ATPase activity, phosphorylative mechanism
GO:0015991 IEA:InterPro P ATP hydrolysis coupled proton transport
GO:0007042 TAS:MGI P lysosomal lumen acidification
GO:0030177 IEA:Ensembl P positive regulation of Wnt signaling pathway
GO:0007035 TAS:MGI P vacuolar acidification

Domain Information

InterPro Annotations

Accession Description
IPR000245 V-ATPase proteolipid subunit
IPR011555 V-ATPase proteolipid subunit C, eukaryotic
IPR002379 V-ATPase proteolipid subunit C-like domain

UniProt Annotations

Entry Information

Gene Name
ATPase, H+ transporting, lysosomal V0 subunit C
Protein Entry
VATL_MOUSE
UniProt ID
Species
Mouse

Identical and Related Proteins

Unique RefSeq proteins for LMP004865 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6753144 RefSeq NP_033859 155 V-type proton ATPase 16 kDa proteolipid subunit

Identical Sequences to LMP004865 proteins

Reference Database Accession Length Protein Name
GI:6753144 GenBank AAH83129.2 155 ATPase, H+ transporting, lysosomal V0 subunit C [Mus musculus]
GI:6753144 GenBank AAH99475.2 155 ATPase, H+ transporting, lysosomal V0 subunit C [Mus musculus]
GI:6753144 GenBank EDL13651.1 155 mCG121835 [Mus musculus]
GI:6753144 GenBank EDL22293.1 155 mCG12839 [Mus musculus]
GI:6753144 GenBank EDM03810.1 155 ATPase, H transporting, lysosomal V0 subunit c, isoform CRA_b [Rattus norvegicus]
GI:6753144 RefSeq XP_006245960.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit isoform X1 [Rattus norvegicus]

Related Sequences to LMP004865 proteins

Reference Database Accession Length Protein Name
GI:6753144 DBBJ BAC25834.1 155 unnamed protein product [Mus musculus]
GI:6753144 DBBJ BAE26942.1 155 unnamed protein product [Mus musculus]
GI:6753144 GenBank AAH50939.1 188 Atp6v0c protein, partial [Mus musculus]
GI:6753144 GenBank EDM03811.1 165 ATPase, H transporting, lysosomal V0 subunit c, isoform CRA_c [Rattus norvegicus]
GI:6753144 RefSeq XP_005081689.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Mesocricetus auratus]
GI:6753144 RefSeq XP_005349252.1 155 PREDICTED: V-type proton ATPase 16 kDa proteolipid subunit [Microtus ochrogaster]